Gene ULK-f5 (S.moellendorffii)
ULK-f5
Species: S.moellendorffii
Alias: ULK-f5
External Links:
Annotation:
Sequence
Protein domains of ULK-f5.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | ULK-f5.AA | CAMKL | 16-71 | 31 | 1e-13 | 40.0 | In-house | 40-110 (297) | Show / Hide |
Range on Protein: 16-71 Range on HMM: 40-110/297 Sequence Identity: 31% (23 aa) MDQFRQQLEL---------IAQEQAIMKSIA---HPNVVKLLGMISEDEH--DELSTRYLVMEFCEGGD--L .|.. .. . | .| .|||.. |||..||. .| .|| . . ||||| |.||. | NDPWMKKNKCGQKHESDMRIRREIQIMKMLNIGKHPNIIKLYEVIETPEHDIET-KKIYLVMEYCSGGEMDL |
|||||||||
| Kinase | ULK-f5.AA | ULK | 16-73 | 31 | 2e-11 | 36.83 | In-house | 41-106 (324) | Show / Hide |
Range on Protein: 16-73 Range on HMM: 41-106/324 Sequence Identity: 31% (22 aa) MDQFRQQ------LELIAQEQAIMKSIA---HPN--VVKLLGMISEDEHDELSTRYLVMEFCEGGDLDQ | .. .. ..|. .| ||| . ||| .|||. . .. | |..||.|.||||.| MNKKKNEQEGQYMWQLLKNEIQIMKKLKELKHPNHHIVKLYDWFETSNH---NNIYIIMEYCNGGDLEQ |
|||||||||
| Kinase | ULK-f5.AA | CAMKK-Unclassified | 18-71 | 37 | 6.1e-11 | 31.57 | In-house | 57-109 (392) | Show / Hide |
Range on Protein: 18-71 Range on HMM: 57-109/392 Sequence Identity: 37% (21 aa) QFRQQLELIAQEQAIMKSIAHPNVVKLLGMISEDEHDELSTRYL--VMEFCEGGDL . . .| |. || |||| ..|||..|| | . | . |. |||.|..|.. KMKNRLHLVQQEIAIMKKLWHPNICKLYEVIDDPDNDKI---YMGQVMEYCQMGQI |
|||||||||
| Kinase | ULK-f5.AA | MARK | 21-75 | 33 | 3.2e-10 | 29.79 | In-house | 41-93 (262) | Show / Hide |
Range on Protein: 21-75 Range on HMM: 41-93/262 Sequence Identity: 33% (19 aa) QQLELIAQEQAIMKSIAHPNVVKLLGMIS--EDEHDELSTRYLVMEFCEGGDLDQCM |... . | .|||.. |||..||. .| . .| . ||.|| ..||.| ... QWMKNVMREIEIMKKLDHPNIIKLFHVIEQDTEQH----QIYLIMEYASGGELYDYI |
|||||||||
| Kinase | ULK-f5.AA | CAMK | 21-72 | 24 | 6.9e-10 | 27.3 | In-house | 73-150 (425) | Show / Hide |
Range on Protein: 21-72 Range on HMM: 73-150/425 Sequence Identity: 24% (19 aa) QQLELIAQEQAIMKSIA-------HPNVVKLLGMISEDEH-------DELST--------RYLVM---EFCEGGDL--D . .. . .| .|||.. |||..||. .. ... . |. |.|| |.|.||.| | KDRKNVRREIEIMKKLQGIGNKLDHPNIIKLYEVYEDPHYFKNTNDYET-SKQVFTKDKHMYMVMEIMEYCSGGELFDD |
|||||||||
| Kinase | ULK-f5.AA | Pkinase_Tyr | 20-72 | 33 | 1.4e-09 | 33.06 | Pfam | 43-95 (270) | Show / Hide |
Range on Protein: 20-72 Range on HMM: 43-95/270 Sequence Identity: 33% (19 aa) RQ--QLELIAQEQAIMKSI-AHPNVVKLLGMIS-EDEHDELSTRYLVMEFCEGGDLD .| . .... | .|||.. |||.|.|.| .. ..|. |.|||....|||. EQNCREDFMR-EAKIMKQLGHHPNIVRLYGVCTDQGEPN---QIYIVMEYMPHGDLL |
|||||||||
| Kinase | ULK-f5.AA | ULK | 21-73 | 34 | 1.5e-09 | 29.61 | In-house | 52-109 (329) | Show / Hide |
Range on Protein: 21-73 Range on HMM: 52-109/329 Sequence Identity: 34% (21 aa) QQLELIAQEQAIMKSIA--------HPNVVKLLGMISEDEHDELSTRYLVMEFCEGGDLDQ ....|. .| ||| . |||.|||. . .. |. . |..||.|.||||.| YMWQLLKNEIKIMKKLKSPNRHKNHHPNIVKLYDWFETSNHNNI---YIIMEYCNGGDLEQ |
|||||||||
| Kinase | ULK-f5.AA | Ciliate-E2 | 26-75 | 37 | 2.5e-09 | 28.15 | In-house | 80-125 (365) | Show / Hide |
Range on Protein: 26-75 Range on HMM: 80-125/365 Sequence Identity: 37% (19 aa) IAQEQAIMKSIAHPNVVKLLGMISE-DEHDELSTRYLVMEFCEGGDLDQCM | .|. |.... |||..|. | |.. . |||||.|.|||| ... I-NEKNILEQLNHPNIIKMYECFQEKDDN----NIYLVMEYCQGGDLFDYI |
|||||||||
| Kinase | ULK-f5.AA | CAMKK | 23-71 | 42 | 4.3e-09 | 24.54 | In-house | 71-117 (396) | Show / Hide |
Range on Protein: 23-71 Range on HMM: 71-117/396 Sequence Identity: 42% (21 aa) LELIAQEQAIMKSIAHPNVVKLLGMISEDEHDELSTRYLV-MEFCEGGDL .... || |||| . |||.||| | . | . |.| ||.||.|.. FDCVYQEIAIMKKCNHPNIVKLYEVIDDPQNDKI---YMVQMEYCERGQI |
|||||||||
| Kinase | ULK-f5.AA | TKL | 15-73 | 20 | 3.5e-08 | 25.56 | In-house | 61-128 (364) | Show / Hide |
Range on Protein: 15-73 Range on HMM: 61-128/364 Sequence Identity: 20% (14 aa) RMDQFRQQLELIAQEQAIMKSIAHPNVVKLLGMISEDEH--------DELSTRYLVMEFCEGGD-LDQ ... .. . . .| .|... |||.|...| . .. .. . ..|||.|.||. |.. NDPEASWFRFFEEEEIMMMSRLRHPNIVQFMGYCCCPPCGCVCMHPVGPWGQLCIVMEYCPGGSLLHY |
|||||||||
| Kinase | ULK-f5.AA | Meta | 23-69 | 42 | 3.7e-08 | 19.59 | In-house | 66-109 (287) | Show / Hide |
Range on Protein: 23-69 Range on HMM: 66-109/287 Sequence Identity: 42% (20 aa) LELIAQEQAIMKSIAHPNVVKLLGMISEDEHDELSTRYLVMEFCEGG |... || ||.| ||||||| . | | |.|.|. |.| LDRVYQEIAILKKLDHPNVVKLVEVLDDPNEDYL---YMVFEYVEKG |
|||||||||
| Pkinase | ULK-f5.AA | Pkinase | 14-71 | 32 | 7.4e-08 | 28.86 | Pfam | 36-91 (293) | Show / Hide |
Range on Protein: 14-71 Range on HMM: 36-91/293 Sequence Identity: 32% (20 aa) SRMDQFRQQLELIAQEQAIMKSIAHPNVVKLLGMISEDEHDELSTRYLVMEFCEGG----DL .. ....|.. .. .| .|||.. |||.|.|... . .|.. .|||.|||| || HEKSWKDQTHRRL-SEIQIMKRLNHPNIVRLYDWFED--KDHIY---MVMEYCEGGLYVMDL |
|||||||||