Gene Haspin (S.moellendorffii)

Haspin

Species: S.moellendorffii
Alias: Haspin
External Links:
Annotation:

Classification

Group: Other
Family: Haspin

Sequence

Name Sequence Type Origin Length Description Download
Haspin.AA Protein None 236 None Fasta, JSON
Haspin.NA RNA None 711 None Fasta, JSON

Protein domain

Protein domains of Haspin.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase Haspin.AA Haspin 2-155 28 1.6e-36 127.65 In-house 92-248 (264) Show / Hide 
Range on Protein: 2-155
Range on HMM: 92-248/264
Sequence Identity: 28% (45 aa)

KNLVRAWKKWDTQHNSENDQPLAFPEEQLYVVFVLADGGTDLESF--ELLNYEEVKSLLLQVVLSLAVAEQAYGFEHRDLHWGNIVLS-RDQHEQLDFRL
| |. .|..... | |||| |  | . ||. ......||..|..|  ....... .| . | |.|...|. ...|.|.||||||. .. .   . |....
KKLNKMWDHYCYTHHSENDRPDFFKKNQLHIHWIMEYGGRPLDNFRWKFNTCNQCISIMCQLVMSMYIAKDEMQFWHNDLHWGNVLIKRKTKKKWLHYTM

ENRHFLVNTHGLSVALIDFTLSRIDTGKQVVFCDLSDPSWFEGPKGDVQADTYRRMK
...   ...||. | .|||..||.. . .....|... . ..   .| | | ||.|.
DGKTIKIKSHGVMVTIIDFCKSRCGKDNKKIYWDWKNDETMFEQFWDYQFDVYRDMR