Gene YAK_d (S.moellendorffii)
YAK_d
Species: S.moellendorffii
Alias: YAK_d
External Links:
Annotation:
Sequence
Protein domains of YAK_d.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | YAK_d.AA | AGC | 23-62 | 45 | 2.9e-19 | 45.03 | In-house | 161-202 (395) | Show / Hide |
Range on Protein: 23-62 Range on HMM: 161-202/395 Sequence Identity: 45% (19 aa) QLLEALQVLER-HGVVHRD-LKPENIVLSSQGELRLIDFGSA ... ||. | . .|..||| ||||||.| ..| ..| |||.. CIVLALEYLHSHMGIIHRDYLKPENILLDEDGHIKLTDFGLC |
|||||||||
Kinase | YAK_d.AA | CMGC | 16-62 | 25 | 4.2e-18 | 55.23 | In-house | 175-251 (513) | Show / Hide |
Range on Protein: 16-62 Range on HMM: 175-251/513 Sequence Identity: 25% (20 aa) DKMSIM------TQLLEALQ--VLERHG--VVHRDLKPENIVLSSQGEL--------------------RLIDFGSA .. ..| |.|..| . .|. ..||||||||| .....|| ...|||.| NIKYFMIHIRYMYQILRGLKLKYCHSHWGNIIHRDLKPENILINHNCELITRMMWKSEDWNPCQKNGRLKICDFGLA |
|||||||||
Kinase | YAK_d.AA | PDK1 | 23-62 | 45 | 1.8e-15 | 43.36 | In-house | 118-157 (307) | Show / Hide |
Range on Protein: 23-62 Range on HMM: 118-157/307 Sequence Identity: 45% (18 aa) QLLEALQVLERHGVVHRDLKPENIVLSSQGELRLIDFGSA ... ||. | ..|..||||||||| |.. . . ..|||.| EIIDALEHLHSNGIIHRDLKPENILLDKDMHIMITDFGTA |
|||||||||
Kinase | YAK_d.AA | CAMK | 20-62 | 31 | 4.1e-15 | 44.46 | In-house | 184-243 (425) | Show / Hide |
Range on Protein: 20-62 Range on HMM: 184-243/425 Sequence Identity: 31% (19 aa) IMTQLLEALQVLERHGVVHRDLKPENIVLSSQ-----------------GELRLIDFGSA .. |...|.. . |..|||||||||| |.. . . .|||| | YFRQICSAVHYCHSHNIVHRDLKPENILLDDNNDDSDPVEHDEIFDWNNNNIKIIDFGFA |
|||||||||
Kinase | YAK_d.AA | CDK | 19-62 | 40 | 5.4e-15 | 44.25 | In-house | 112-160 (284) | Show / Hide |
Range on Protein: 19-62 Range on HMM: 112-160/284 Sequence Identity: 40% (20 aa) SIMTQLLEALQVLERHGVVHRDLKPENIVLSSQGE-----LRLIDFGSA ..| |||..| . .....|||||| || ....|| | . ||| | CYMWQLLRGLHYCHSNWIMHRDLKPQNILINNNGEVKCGRLKIADFGLA |
|||||||||
Kinase | YAK_d.AA | MSK | 20-62 | 45 | 1.1e-14 | 46.11 | In-house | 106-151 (277) | Show / Hide |
Range on Protein: 20-62 Range on HMM: 106-151/277 Sequence Identity: 45% (21 aa) IMTQLLEALQVLERHGVVHRDLKPENIVLSSQ---GELRLIDFGSA || .| |.. . |..||||||||| . .. |...|||||.| IMRELVMAVDHMHQKGIIHRDLKPENILFDDEEDNGHVKLIDFGFA |
|||||||||
Kinase | YAK_d.AA | CDC2 | 19-60 | 38 | 1.5e-14 | 40.65 | In-house | 107-148 (301) | Show / Hide |
Range on Protein: 19-60 Range on HMM: 107-148/301 Sequence Identity: 38% (16 aa) SIMTQLLEALQVLERHGVVHRDLKPENIVLSSQGELRLIDFG |.| |.|... . .....|||||| || ....|.... ||| SYMYQILQGVHFCHQRRIMHRDLKPQNILIDKKGNIKIADFG |
|||||||||
Kinase | YAK_d.AA | RSK | 20-62 | 39 | 2.1e-14 | 49.34 | In-house | 109-154 (278) | Show / Hide |
Range on Protein: 20-62 Range on HMM: 109-154/278 Sequence Identity: 39% (18 aa) IMTQLLEALQVLERHGVVHRDLKPENIVLSS---QGELRLIDFGSA .| .. |.. | .|..|||||||||.. . .|...|.||| . YMAEIVLAVEHLHQQGIIHRDLKPENILYDDESNEGHIKLTDFGFC |
|||||||||
Kinase | YAK_d.AA | CDK4 | 20-60 | 48 | 4.7e-14 | 44.41 | In-house | 115-155 (290) | Show / Hide |
Range on Protein: 20-60 Range on HMM: 115-155/290 Sequence Identity: 48% (20 aa) IMTQLLEALQVLERHGVVHRDLKPENIVLSSQGELRLIDFG .| ||| .. | | ..||||||.|| ..|.|.. | ||| MMHQLLRGVDFLHSHRIIHRDLKPQNILVTSDGHVKLADFG |
|||||||||
Kinase | YAK_d.AA | CAMKL | 22-62 | 44 | 6.3e-14 | 40.68 | In-house | 134-176 (297) | Show / Hide |
Range on Protein: 22-62 Range on HMM: 134-176/297 Sequence Identity: 44% (19 aa) TQLLEALQVLERHGVVHRDLKPENIVLSSQG--ELRLIDFGSA .|...|.. . .||.||||.||||| |...| . .|||| . RQIVSAVNYCHSHGIVHRDIKPENILLDENGNNNIKIIDFGFS |
|||||||||
Kinase | YAK_d.AA | Pkinase | 19-62 | 39 | 2.8e-13 | 48.05 | Pfam | 112-159 (293) | Show / Hide |
Range on Protein: 19-62 Range on HMM: 112-159/293 Sequence Identity: 39% (19 aa) SIMTQLLEALQVLERHGVVHRDLKPENIVLSSQGEL----RLIDFGSA ..|.|.|..|. . ..|..||||||||| ....|.. ...|||.| FYMYQILRGLEYCHSMGIIHRDLKPENILIDNNGHIDACVKICDFGLA |