Gene ABC1-F_b (S.moellendorffii)
ABC1-F_b
Species: S.moellendorffii
Alias: ABC1-F_b
External Links:
Annotation:
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
ABC1-F_b.AA | Protein | None | 613 | None | Fasta, JSON |
ABC1-F_b.NA | RNA | None | 1842 | None | Fasta, JSON |
Protein domains of ABC1-F_b.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
ABC1 | ABC1-F_b.AA | ABC1 | 90-194 | 40 | 2.5e-35 | 121.06 | Pfam | 1-110 (126) | Show / Hide |
Range on Protein: 90-194 Range on HMM: 1-110/126 Sequence Identity: 40% (44 aa) KELGAHTSEIFAEISKEPLAAASLGQVYKAKLFS-GETVAVKVLRPGVPARLALDARLLNLVGGQLQRFTRA---RG-DVAAVVNEMVAHMLEETDYLNE .|||. .|||.|...||.||||..||..|.| . ||.|||||..||| |. .| ... .. ..|| .. | ..|.|. . .| ||..| EELGCPWEEIFQEFDEEPIAAASIAQVHRARLKDDGEEVAVKVQHPGVKKRMMRDIYNMRWMAKWVKRFFPGYRRQRFDLMWIVDEFRKNLPWELDYRRE AKNTERFASL |||.|||. . AKNMERFREN |
|||||||||
Kinase | ABC1-F_b.AA | ABC1 | 90-136 | 51 | 2.3e-16 | 60.6 | In-house | 1-46 (123) | Show / Hide |
Range on Protein: 90-136 Range on HMM: 1-46/123 Sequence Identity: 51% (24 aa) KELGAHTSEIFAEISKEPLAAASLGQVYKAKLFSGETVAVKVLRPGV ..|| ..| | ...|.||||..|| .||| .|.||||||. ||| QDLG-NWEDVFSEFDEKPFAAASIAQVHRAKLKDGQTVAVKVQHPGV |
|||||||||
Kinase | ABC1-F_b.AA | ABC1-B | 90-131 | 57 | 2.5e-14 | 49.08 | In-house | 1-41 (125) | Show / Hide |
Range on Protein: 90-131 Range on HMM: 1-41/125 Sequence Identity: 57% (24 aa) KELGAHTSEIFAEISKEPLAAASLGQVYKAKLFSGETVAVKV | || ..| | ...|.||||| || .||| |||||||| KDLG-NIEDVFSEFDQKPIAAASLAQVHRAKLHDGETVAVKV |
|||||||||
Kinase | ABC1-F_b.AA | ABC1-A | 103-136 | 50 | 5.9e-09 | 27.37 | In-house | 1-34 (216) | Show / Hide |
Range on Protein: 103-136 Range on HMM: 1-34/216 Sequence Identity: 50% (17 aa) ISKEPLAAASLGQVYKAKLFSGETVAVKVLRPGV | |.|| ||| .| | .| ||||. ||| FEEMPFACASIGQVHQAVLKDGREVAVKIQYPGV |
|||||||||
Kinase | ABC1-F_b.AA | TKL | 108-133 | 28 | 0.000909 | 9.46 | In-house | 1-35 (364) | Show / Hide |
Range on Protein: 108-133 Range on HMM: 1-35/364 Sequence Identity: 28% (10 aa) LAAASLGQVYKAKLFS---------GETVAVKVLR . . |.|||.|. |..||||... IGSGGFGEVYKGKWRGWGGKCPSDTGKDVAVKKFK |
|||||||||
Kinase | ABC1-F_b.AA | ABC1-C | 127-143 | 58 | 0.002102 | 5.95 | In-house | 1-17 (307) | Show / Hide |
Range on Protein: 127-143 Range on HMM: 1-17/307 Sequence Identity: 58% (10 aa) VAVKVLRPGVPARLALD |||||| ||. | .| VAVKVLHPGLLAQVHMD |
|||||||||
Kinase | ABC1-F_b.AA | ABC1 | 175-194 | 40 | 0.041688 | 5.72 | In-house | 89-108 (123) | Show / Hide |
Range on Protein: 175-194 Range on HMM: 89-108/123 Sequence Identity: 40% (8 aa) MLEETDYLNEAKNTERFASL . .| |..|||.| |... | LPWECDFNNEARNAEKCRQL |
|||||||||
Kinase | ABC1-F_b.AA | ABC1-A | 216-238 | 43 | 0.05374 | 3.03 | In-house | 98-120 (216) | Show / Hide |
Range on Protein: 216-238 Range on HMM: 98-120/216 Sequence Identity: 43% (10 aa) VKVPKIFWRYTTKGVLTMEWIDG . ||... |.| ||||| . | FYVPHVIDEYCTDRVLTMELMYG |
|||||||||
Kinase | ABC1-F_b.AA | ABC1-C | 272-286 | 66 | 0.039271 | 1.9 | In-house | 132-146 (307) | Show / Hide |
Range on Protein: 272-286 Range on HMM: 132-146/307 Sequence Identity: 66% (10 aa) DGFFHADPHPGNLVV | | ||| ||||..| DNFVHADLHPGNILV |
|||||||||
Kinase | ABC1-F_b.AA | ABC1-C | 386-413 | 35 | 0.05282 | 1.49 | In-house | 280-307 (307) | Show / Hide |
Range on Protein: 386-413 Range on HMM: 280-307/307 Sequence Identity: 35% (10 aa) FGLVIRALGSLEGTATTLDPEFRVIESA | .. |. ||| ||| ..| | FASIVFAIMVLEGLGRSLDPKLDILEAA |