Gene CC1G_07742 (C.cinerea)

CC1G_07742

Species: C.cinerea
Alias: CC1G_07742
External Links:
Annotation:

Classification

Group: TKL
Family: TKL-ccin

Sequence

Name Sequence Type Origin Length Description Download
CC1G_07742.AA Protein None 638 None Fasta, JSON
CC1G_07742.NA RNA None 1917 None Fasta, JSON
CC1G_07742.kin_dom Protein Kinase Domain None 1 None Fasta, JSON

Protein domain

Protein domains of CC1G_07742.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
MMR_HSR1 CC1G_07742.AA MMR_HSR1 431-481 25 0.000724 16.95 Pfam 1-47 (111) Show / Hide 
Range on Protein: 431-481
Range on HMM: 1-47/111
Sequence Identity: 25% (13 aa)

GKSTFINCAMRSRVARVTHSVQSCTEKIHVYGCHHPTKQDRRVFFIDTPGF
||||..|   ....|.|..  . .|  .. .  ..   ..|.. ..||||.
GKSTLFNALTGRKRAIVSDYPG-TTRDPNYGRIDW---DGRQFILVDTPGI