Gene CC1G_15847 (C.cinerea)

CC1G_15847

Species: C.cinerea
Alias: CC1G_15847
External Links:
Annotation:

Classification

Group: PKL
Family: PKL-Unique

Sequence

Name Sequence Type Origin Length Description Download
CC1G_15847.AA Protein None 752 None Fasta, JSON
CC1G_15847.NA RNA None 2259 None Fasta, JSON
CC1G_15847.kin_dom Protein Kinase Domain None 131 None Fasta, JSON

Protein domain

Protein domains of CC1G_15847.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
APH CC1G_15847.AA APH 414-636 17 0.000383 15.01 Pfam 1-200 (248) Show / Hide 
Range on Protein: 414-636
Range on HMM: 1-200/248
Sequence Identity: 17% (40 aa)

VVTRVSGGLANHTYRVSLDPGSSMDGNVPSLILKYSPPTIALNPDHPLTTKRGFFE-YSALANV--PNIQTSSPC-RVHTPSTIHYDEAAHLLAISDAGP
 ....|||  | ||..  | .       |...|.  ||       ... . . ... . .||.   |      |. ||.   |.....  . ....  . 
WWRPISGGWSNRTYYRTTDDR-------PRYVLRRYPPP------WWAEELHREHRWLRHLAAHGIP-----VPVPRVLWGCTDDEFHGWPWYLMEWLPG

HSQTLKQHLLD-NADLNYSQIGQSLGEWLAELHQWGQTDAAAPLRSI---LSQNLEMADVGLQYTFAGLVPE--DDPLWSAVRSHVESLRKSDDNTGGFV
.. .        . .    .... |.. ||.|||   ...... ...   | .  . .|  ... .... .|     ||  .. . |...       ...
EDLWRW----HALHCAQRPALLEALARFLARLHQVD-PPDCPFAWWGRWRLYHWRQLMDWCRCWVDPEWFDEDRQWWLWQRLWAWLEAHWP----PPCWC

VHGDFWTGNVLVSTENDSAEGDVDLKL-TVLDWE
 ||||. |||....       . . ..  |.||.
-HGDFHPGNVMWDP------RPDGGRVTGVIDWD