Gene CC1G_15848 (C.cinerea)
CC1G_15848
Species: C.cinerea
Alias: CC1G_15848
External Links:
Annotation:
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
CC1G_15848.AA | Protein | None | 456 | None | Fasta, JSON |
CC1G_15848.NA | RNA | None | 1371 | None | Fasta, JSON |
CC1G_15848.kin_dom | Protein Kinase Domain | None | 124 | None | Fasta, JSON |
Protein domains of CC1G_15848.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | CC1G_15848.AA | Ciliate-E8 | 402-437 | 31 | 2e-06 | 16.13 | In-house | 101-138 (138) | Show / Hide |
Range on Protein: 402-437 Range on HMM: 101-138/138 Sequence Identity: 31% (12 aa) VIDHMHQLKVHHHDLHPQNVVRNG--DGKLTLIDFGFS .. |.. . | |. |.. | | .|||||| AFCYLHNNNIIHCDFKLNNILVQRNDDTKIKIIDFGFS |
|||||||||
Kinase | CC1G_15848.AA | Ciliate-E9 | 403-441 | 35 | 2e-06 | 16.09 | In-house | 124-163 (298) | Show / Hide |
Range on Protein: 403-441 Range on HMM: 124-163/298 Sequence Identity: 35% (14 aa) IDHMHQLK-VHHHDLHPQNVVRNGDGKLTLIDFGFSGPCT |..||| . . | || | |.. . . ..|||.| |. IEYMHQYQNICHRDLKPENMLIDKNYNMKICDFGMSAQCR |
|||||||||
Kinase | CC1G_15848.AA | MSK | 403-437 | 44 | 4e-06 | 16.74 | In-house | 114-151 (277) | Show / Hide |
Range on Protein: 403-437 Range on HMM: 114-151/277 Sequence Identity: 44% (17 aa) IDHMHQLKVHHHDLHPQNVVRNGD---GKLTLIDFGFS .|||||... | || | |. .. |.. ||||||. VDHMHQKGIIHRDLKPENILFDDEEDNGHVKLIDFGFA |
|||||||||
Kinase | CC1G_15848.AA | SNRK | 403-437 | 55 | 1.7e-05 | 13.66 | In-house | 112-147 (254) | Show / Hide |
Range on Protein: 403-437 Range on HMM: 112-147/254 Sequence Identity: 55% (20 aa) IDHMHQLKVHHHDLHPQNVV-RNGDGKLTLIDFGFS || |||.| | || | ||| . | | ||||| IDYCHQLHVVHRDLKPENVVFFEKQGMVKLTDFGFS |
|||||||||
Kinase | CC1G_15848.AA | NIM1 | 405-448 | 31 | 4.3e-05 | 10.91 | In-house | 115-158 (258) | Show / Hide |
Range on Protein: 405-448 Range on HMM: 115-158/258 Sequence Identity: 31% (14 aa) HMHQLKVHHHDLHPQNVVRNGDGKLTLIDFGFSGPCTRGGDCSD ||| . . | |. || . . . ||||| | .| .. HMHSRNIVHRDIKAENVMYTSNNCVKVGDFGFSCYCKMGTGANQ |
|||||||||
Kinase | CC1G_15848.AA | DAPK | 405-437 | 35 | 5.1e-05 | 9.45 | In-house | 118-154 (264) | Show / Hide |
Range on Protein: 405-437 Range on HMM: 118-154/264 Sequence Identity: 35% (13 aa) HMHQLKVHHHDLHPQNVVRNG----DGKLTLIDFGFS ..|.... | || |||. . .|.. .|||| | YLHSRNICHLDLKPQNIMLTDRNIPQGDIKIIDFGLS |
|||||||||
Kinase | CC1G_15848.AA | CMGC | 403-437 | 20 | 0.0001 | 10.44 | In-house | 193-251 (513) | Show / Hide |
Range on Protein: 403-437 Range on HMM: 193-251/513 Sequence Identity: 20% (12 aa) ID--HMHQLK--VHHHDLHPQNVVRNGD--------------------GKLTLIDFGFS .. ..|. . . | || |.|. | . |.| ..|||.. LKLKYCHSHWGNIIHRDLKPENILINHNCELITRMMWKSEDWNPCQKNGRLKICDFGLA |
|||||||||
Kinase | CC1G_15848.AA | Ciliate-C3 | 403-434 | 31 | 0.00015 | 12.67 | In-house | 109-140 (140) | Show / Hide |
Range on Protein: 403-434 Range on HMM: 109-140/140 Sequence Identity: 31% (10 aa) IDHMHQLKVHHHDLHPQNVVRNGDGKLTLIDF || .| . | |. ..|.. | ... .||| IDYLHEHNIVHGDIKFSNILINSKDEIKIIDF |
|||||||||
Kinase | CC1G_15848.AA | MSN | 405-437 | 45 | 0.000167 | 10.52 | In-house | 119-151 (265) | Show / Hide |
Range on Protein: 405-437 Range on HMM: 119-151/265 Sequence Identity: 45% (15 aa) HMHQLKVHHHDLHPQNVVRNGDGKLTLIDFGFS |.|| || | |. |||. . .. |.||| | HLHQHKVIHRDIKGQNVLLTHNAEVKLVDFGVS |
|||||||||
Kinase | CC1G_15848.AA | PCTAIRE | 407-435 | 51 | 0.000188 | 11.53 | In-house | 114-142 (291) | Show / Hide |
Range on Protein: 407-435 Range on HMM: 114-142/291 Sequence Identity: 51% (15 aa) HQLKVHHHDLHPQNVVRNGDGKLTLIDFG |. |. | || ||| | .| | | ||| HRRKILHRDLKPQNLLINERGELKLADFG |