Gene CC1G_05344 (C.cinerea)
CC1G_05344
Species: C.cinerea
Alias: CC1G_05344
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| CC1G_05344.AA | Protein | None | 705 | None | Fasta, JSON |
| CC1G_05344.NA | RNA | None | 2118 | None | Fasta, JSON |
| CC1G_05344.kin_dom | Protein Kinase Domain | None | 364 | None | Fasta, JSON |
Protein domains of CC1G_05344.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| APH | CC1G_05344.AA | APH | 372-398 | 27 | 0.001207 | 13.31 | Pfam | 176-204 (248) | Show / Hide |
Range on Protein: 372-398 Range on HMM: 176-204/248 Sequence Identity: 27% (8 aa) DYALRNMLFH--PDSEEIVAFLDWDDVAI |. ..|.... || .......||||. . DFHPGNVMWDPRPDGGRVTGVIDWDDACW |
|||||||||
| APH | CC1G_05344.AA | APH | 433-492 | 25 | 0.000485 | 14.66 | Pfam | 148-204 (248) | Show / Hide |
Range on Protein: 433-492 Range on HMM: 148-204/248 Sequence Identity: 25% (16 aa) DEEERWRPRLRGSEASWRSPNLPELFSPCVVPMDYALRNMLFH--PDSEEIVAFLDWDDVAI ||...|. . | . | ...| ||.. |. ..|.... || .......||||. . DEDRQWWLWQR--LWAWLEAHWP---PPCWCHGDFHPGNVMWDPRPDGGRVTGVIDWDDACW |
|||||||||