CC1G_06893

Species: C.cinerea
Alias: CC1G_06893
External Links:
Annotation: Secondary Group: Atypical, Secondary Family: HisK

Classification

Group: PKL
Family: CAK
Subfamily: ACAD

Sequence

Name Sequence Type Origin Length Description Download
CC1G_06893.AA Protein None 392 None Fasta, JSON
CC1G_06893.NA RNA None 1179 None Fasta, JSON
CC1G_06893.kin_dom Protein Kinase Domain None 231 None Fasta, JSON

Protein domain

Protein domains of CC1G_06893.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
APH CC1G_06893.AA APH 41-326 21 3.2e-40 138.08 Pfam 1-248 (248) Show / Hide
Range on Protein: 41-326
Range on HMM: 1-248/248
Sequence Identity: 21% (65 aa)

AVKQFKFGQSNPTYFLTAADGVKFVLRKKPAGQLLSPTAHQVEREYQILAALHKHNLKPTTPTEKKVPVPEPIILCEDSSVVGTPFYIMEFLDGRIFTDV
 ....  |.||.||..|. |....|||  |..     .| ...||...|..|..| .         ||||... .|.| .. |.|.|.||.|.|......
WWRPISGGWSNRTYYRTTDDRPRYVLRRYPPP----WWAEELHREHRWLRHLAAHGIP--------VPVPRVLWGCTDDEFHGWPWYLMEWLPGEDLWRW

RMLE-VSPKDRRECWLSAVGALAALGSVDPKEVGLEKFGPSSDYFPRQIKSL--SRVSSAQAE---AVDIDTGRKVGNIPFYDELVAWYRANLPDEKKLG
   .  ....|.. .  .. .||.| .|||  .... .|.   |. ||. .     | ..  .   . ...             | || .|..|      
---HALHCAQRPALLEALARFLARLHQVDPPDCPFAWWGRWRLYHWRQLMDWCRCWVDPEWFDEDRQWWLWQR-----------LWAWLEAHWP-----P

LRIVHGDYKLDNLIFH--PTENYVIGILDWELCTLGSPLADLGNLTQP-WAIDLKNLSDAPGFLRGFKNTTVDVPIPLEDLEREYC---RLLKQPYPI
....|||....|....  |... |.|..||. ...| |..||. .    |  ..                    | ..... |.||   ... .  ..
PCWCHGDFHPGNVMWDPRPDGGRVTGVIDWDDACWGDPHYDLAMCWWHWWCRWFW-------------------PEWRDAYGRAYCRHDPDWHRMRWW