CC1G_03687

Species: C.cinerea
Alias: CC1G_03687
External Links:
Annotation:

Classification

Group: Other
Family: Other-Unique

Sequence

Name Sequence Type Origin Length Description Download
CC1G_03687.AA Protein None 649 None Fasta, JSON
CC1G_03687.NA RNA None 1950 None Fasta, JSON
CC1G_03687.kin_dom Protein Kinase Domain None 41 None Fasta, JSON

Protein domain

Protein domains of CC1G_03687.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_03687.AA CK1 206-246 21 0.000226 11.26 In-house 140-196 (339) Show / Hide
Range on Protein: 206-246
Range on HMM: 140-196/339
Sequence Identity: 21% (12 aa)

RCIEAYEHLHSRGILHGNVGLDKIAIGGDG----------------RVTLLDFSQAK
...|| |..|..|..| ..  | ...|  .                .| ..||  |.
QMLEALEYMHDCGFIHRDIKPDNFCMGRNESFKYGKHHHEWNNEHRQVYMIDFGMAR

Kinase CC1G_03687.AA Ciliate-C3 208-242 28 0.000282 11.69 In-house 106-140 (140) Show / Hide
Range on Protein: 208-242
Range on HMM: 106-140/140
Sequence Identity: 28% (10 aa)

IEAYEHLHSRGILHGNVGLDKIAIGGDGRVTLLDF
. | . ||   | || . .  | |   ... ..||
LQAIDYLHEHNIVHGDIKFSNILINSKDEIKIIDF