CC1G_07207

Species: C.cinerea
Alias: CC1G_07207
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_07207.AA Protein None 885 None Fasta, JSON
CC1G_07207.NA RNA None 2658 None Fasta, JSON
CC1G_07207.kin_dom Protein Kinase Domain None 472 None Fasta, JSON

Protein domain

Protein domains of CC1G_07207.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_07207.AA Ste20-DD1 534-561 46 0.000285 10.31 In-house 112-139 (268) Show / Hide
Range on Protein: 534-561
Range on HMM: 112-139/268
Sequence Identity: 46% (13 aa)

VLYGIIHALLLLFGGRWVHRDISSGNVL
..|.|.  |  |   | .||||  ||||
ICYQIVKGLVYLHSNRITHRDIKAGNVL

Kinase CC1G_07207.AA TAO 534-613 32 0.00052 8.67 In-house 104-168 (254) Show / Hide
Range on Protein: 534-613
Range on HMM: 104-168/254
Sequence Identity: 32% (26 aa)

VLYGIIHALLLLFGGRWVHRDISSGNVLGLLETSPDGELRYQAKLGDLEYARRYPPADDYVAGIDPKTGTPFFMPCEILL
.  | ...|  |   . .||||  ||.| | | .       | ||.|   |    ||. .|       |||..|  |..|
ICHGALQGLRYLHSHKMIHRDIKAGNIL-LTEHG-------QVKLADFGSASMVCPANSFV-------GTPYWMAPEVIL