Gene CC1G_07012 (C.cinerea)

CC1G_07012

Species: C.cinerea
Alias: CC1G_07012
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_07012.AA Protein None 736 None Fasta, JSON
CC1G_07012.NA RNA None 2211 None Fasta, JSON
CC1G_07012.kin_dom Protein Kinase Domain None 417 None Fasta, JSON

Protein domain

Protein domains of CC1G_07012.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_07012.AA Ciliate-E2 424-491 19 0.000128 11.76 In-house 183-278 (365) Show / Hide 
Range on Protein: 424-491
Range on HMM: 183-278/365
Sequence Identity: 19% (21 aa)

VHRDVSPGNIFAFRATADAPWQVKLSDLEHAKRFPD---------------PGSSDGDRTTG----------------TPYFIAYEVLDSQHL-------
.|||  | ||.           .|..|.  .|.. |                 ..| .||.|                ||.. | |.| ..         
IHRDIKPENILF----------IKIIDFGLSKKYDDDNQNRTHKQQCKWYMF-KNDTSRTPGYMDQIIQQNMFNTICGTPGYMAPEILNGKKYDNQQKQK

-YPTEVD
 | ...|
GYDYKCD
Kinase CC1G_07012.AA ROCK 422-483 35 0.000203 10.6 In-house 118-174 (263) Show / Hide 
Range on Protein: 422-483
Range on HMM: 118-174/263
Sequence Identity: 35% (22 aa)

GWVHRDVSPGNIFAFRATADAPWQVKLSDLEHAKRFPDPGSSDGDRTTGTPYFIAYEVLDSQ
|..|||| | |.       |    .|| |     .    |    |   ||| .|. ||| ||
GFIHRDVKPDNML-----LDKYGHLKLADFGTCMKMNKNGMVRCDTAVGTPDYISPEVLKSQ