Gene CC1G_15588 (C.cinerea)
CC1G_15588
Species: C.cinerea
Alias: CC1G_15588
External Links:
Annotation:
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
CC1G_15588.AA | Protein | None | 443 | None | Fasta, JSON |
CC1G_15588.NA | RNA | None | 1332 | None | Fasta, JSON |
CC1G_15588.kin_dom | Protein Kinase Domain | None | 192 | None | Fasta, JSON |
Protein domains of CC1G_15588.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | CC1G_15588.AA | ASK | 315-346 | 46 | 3.3e-07 | 19.84 | In-house | 101-132 (254) | Show / Hide |
Range on Protein: 315-346 Range on HMM: 101-132/254 Sequence Identity: 46% (15 aa) RAMLKGLAFLHKNLIVHRDMSTGNAVINQFSG . .|.|| .|| | |||||. | ..| .|| KQILEGLKYLHENQIVHRDIKGDNVLVNTYSG |
|||||||||
Kinase | CC1G_15588.AA | CDC7 | 294-333 | 20 | 3e-06 | 13.22 | In-house | 94-133 (522) | Show / Hide |
Range on Protein: 294-333 Range on HMM: 94-133/522 Sequence Identity: 20% (8 aa) ETLKEYFFPMWATLSDVVEFIRAMLKGLAFLHKNLIVHRD .. ....| | .. . . ...... |...|.. |.||| CSFQDFYFHMNRDMEEIKHYMYNLFYALRHVHQFGIIHRD |
|||||||||
Kinase | CC1G_15588.AA | CDK7 | 317-334 | 50 | 4e-06 | 11.98 | In-house | 111-128 (288) | Show / Hide |
Range on Protein: 317-334 Range on HMM: 111-128/288 Sequence Identity: 50% (9 aa) MLKGLAFLHKNLIVHRDM .|.|| ..|.| | |||. TLQGLEYCHRNWILHRDL |
|||||||||
Kinase | CC1G_15588.AA | DYRK2 | 306-334 | 44 | 5e-06 | 15.17 | In-house | 100-128 (318) | Show / Hide |
Range on Protein: 306-334 Range on HMM: 100-128/318 Sequence Identity: 44% (13 aa) TLSDVVEFIRAMLKGLAFLHKNLIVHRDM .|. | |.. .|..| ||||| |.| |. SLQLVRRFAHSILQCLRFLHKNNIIHCDL |
|||||||||
Kinase | CC1G_15588.AA | STE11-Unclassified | 318-334 | 58 | 9e-06 | 16.5 | In-house | 117-133 (308) | Show / Hide |
Range on Protein: 318-334 Range on HMM: 117-133/308 Sequence Identity: 58% (10 aa) LKGLAFLHKNLIVHRDM |.|||.||.. |.|||. LEGLAYLHSHGIIHRDI |
|||||||||
Kinase | CC1G_15588.AA | NZAK | 308-342 | 25 | 1.1e-05 | 14.57 | In-house | 105-139 (329) | Show / Hide |
Range on Protein: 308-342 Range on HMM: 105-139/329 Sequence Identity: 25% (9 aa) SDVVEFIRAMLKGLAFLHKNLIVHRDMSTGNAVIN . . | . ... .||| |.|||. . | . . HRIIKMIADIAETMSYLHKHHIIHRDIKSNNVILD |
|||||||||
Kinase | CC1G_15588.AA | Dicty2 | 313-333 | 47 | 1.2e-05 | 15.79 | In-house | 108-128 (264) | Show / Hide |
Range on Protein: 313-333 Range on HMM: 108-128/264 Sequence Identity: 47% (10 aa) FIRAMLKGLAFLHKNLIVHRD .|. .||||. || . ..||| YIYQVLKGLVYLHRQGVIHRD |
|||||||||
Kinase | CC1G_15588.AA | IRE | 308-334 | 37 | 1.6e-05 | 14.69 | In-house | 116-142 (292) | Show / Hide |
Range on Protein: 308-334 Range on HMM: 116-142/292 Sequence Identity: 37% (10 aa) SDVVEFIRAMLKGLAFLHKNLIVHRDM ... . |. ...||..|| |||||. IRMWQLIKQCMNGLQHLHSQNIVHRDL |
|||||||||
Kinase | CC1G_15588.AA | CDK-Unclassified | 307-338 | 44 | 1.7e-05 | 13.9 | In-house | 118-151 (324) | Show / Hide |
Range on Protein: 307-338 Range on HMM: 118-151/324 Sequence Identity: 44% (15 aa) LS--DVVEFIRAMLKGLAFLHKNLIVHRDMSTGN || .. | . ||.|.|.|| | | ||| . | LSMCQIRNFMHQMLEGIAYLHCNKIMHRDIKPQN |
|||||||||
Kinase | CC1G_15588.AA | DAPK | 309-334 | 34 | 1.8e-05 | 10.72 | In-house | 104-129 (264) | Show / Hide |
Range on Protein: 309-334 Range on HMM: 104-129/264 Sequence Identity: 34% (9 aa) DVVEFIRAMLKGLAFLHKNLIVHRDM |...|.. |.|. .|| . |.| |. DATRFMKQILEGVHYLHSRNICHLDL |