Gene CC1G_14302 (C.cinerea)

CC1G_14302

Species: C.cinerea
Alias: CC1G_14302
External Links:
Annotation:

Classification

Group: Atypical
Family: Alpha
Subfamily: Alpha-Unclassified

Sequence

Name Sequence Type Origin Length Description Download
CC1G_14302.AA Protein None 652 None Fasta, JSON
CC1G_14302.NA RNA None 1959 None Fasta, JSON
CC1G_14302.kin_dom Protein Kinase Domain None 248 None Fasta, JSON

Protein domain

Protein domains of CC1G_14302.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_14302.AA Alpha-Unclassified 504-598 20 3.1e-09 26.1 In-house 118-215 (215) Show / Hide 
Range on Protein: 504-598
Range on HMM: 118-215/215
Sequence Identity: 20% (22 aa)

FRKFTGNDE----MGPPEDAITAAVHAFAHFSYVYSGGDLVFCDLQG--GRDSSGRVCLVDPQCHTLSKAKDSPVYW--DGGPSKIKIVIDKHLQ--DCS
|.|.  |.     .   |.  .    .. |..|  ... .. |||||  .   ..   . ||| ||. .      |   ..  .. .|   . ..   | 
FVKYSNNTGKEINFVKWEYEAYQYCCTYQHWTYQWTNHCDIVCDLQGWVDENDKKTWKMTDPQIHTIRQR-----YQGFKTNCGMRFIDYWFNNHHVQC-

QNQYC
 |.||
-NHYC
Alpha_kinase CC1G_14302.AA Alpha_kinase 504-563 32 1.6e-08 30.66 Pfam 127-190 (225) Show / Hide 
Range on Protein: 504-563
Range on HMM: 127-190/225
Sequence Identity: 32% (21 aa)

FRKFTGND----EMGPPEDAITAAVHAFAHFSYVYSGGDLVFCDLQGGRDSSG-RVCLVDPQCHT
|.|...|.    .   ..| .  .. || ||.|..|.| .. ||.||. . ..  ..| ||| ||
FVKYNNNYGWVYDNMDRNDPWNQYMQAFSHFTYHRSNGQMMVCDIQGVGY-NNKCYYLTDPQIHT
Kinase CC1G_14302.AA Alpha 526-598 32 2.6e-08 19.59 In-house 146-215 (215) Show / Hide 
Range on Protein: 526-598
Range on HMM: 146-215/215
Sequence Identity: 32% (26 aa)

AFAHFSYVYSGGDLVFCDLQ-GGRDSSGRVCLVDPQCHT---LSKAKDSPVYWDG--GPSKIKIVIDKHLQDCSQNQYC
|| |... ||.| |. .||| |     |   | ||| |.   |.. .   .. ||  |.....  . .|   |  | ||
AFSHWTWQYSNGQLMVVDLQWGV----GEWKLTDPQIHCPAKLDQGM---KFGDGNCGYEGMFRFFYTHHVQC--NHYC
Kinase CC1G_14302.AA VWL 526-568 44 5.3e-08 20.04 In-house 138-176 (206) Show / Hide 
Range on Protein: 526-568
Range on HMM: 138-176/206
Sequence Identity: 44% (19 aa)

AFAHFSYVYSGGDLVFCDLQGGRDSSGRVCLVDPQCHTLSKAK
|| ||.. || | .   ||||. |  |   | ||| |.| ...
AFSHFTWQYSQGYCMIVDLQGNED--G--MLTDPQIHCLDQSH