Gene n1200 (Tetrahymena)

n1200

Species: Tetrahymena
Alias: 92.m00096, n1200, 1200
External Links:
Annotation:

Classification

Group: Other
Family: Ciliate-C5

Sequence

Name Sequence Type Origin Length Description Download
n1200.AA Protein None 83 None Fasta, JSON
n1200.NA RNA None 249 None Fasta, JSON

Protein domain

Protein domains of n1200.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase n1200.AA Ciliate-C5 15-50 72 6.4e-15 45.32 In-house 1-36 (260) Show / Hide 
Range on Protein: 15-50
Range on HMM: 1-36/260
Sequence Identity: 72% (26 aa)

IYLSSYISQCGFGCVFEYKYNEQIVAVKYNKVKKSK
||| ||||| ||||||| |||| |||||  |..  |
IYLTSYISQGGFGCVFEAKYNEEIVAVKCSKPNFEK
Kinase n1200.AA Type2 15-42 33 0.000444 9.13 In-house 1-33 (315) Show / Hide 
Range on Protein: 15-42
Range on HMM: 1-33/315
Sequence Identity: 33% (11 aa)

IYLSSYISQCGFGCVFEYKYNEQ-----IVAVK
| |.  |.. .||||.  .....     .||||
IQLMELIGKGRFGCVWKAQWHNNNGEKRTVAVK
Kinase n1200.AA Ciliate-C5 55-83 58 4.7e-05 12.3 In-house 109-137 (260) Show / Hide 
Range on Protein: 55-83
Range on HMM: 109-137/260
Sequence Identity: 58% (17 aa)

YQKNYSNNLKHSDAKIESILYNSQGKYFN
..|   ||| ||| | | |||.|| | ||
FEKIQQNNLIHSDVKPENILYDSQEKCFN