Gene n1218 (Tetrahymena)

n1218

Species: Tetrahymena
Alias: 92.m00099, 1218, n1218
External Links:
Annotation:

Classification

Group: Other
Family: Ciliate-C5

Sequence

Name Sequence Type Origin Length Description Download
n1218.AA Protein None 116 None Fasta, JSON
n1218.NA RNA None 348 None Fasta, JSON

Protein domain

Protein domains of n1218.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase n1218.AA Ciliate-C5 30-56 66 4.6e-11 32.4 In-house 2-28 (260) Show / Hide 
Range on Protein: 30-56
Range on HMM: 2-28/260
Sequence Identity: 66% (18 aa)

YQSQFISQGSFGCAFEAKQNEQIVAAK
|   .||||.||| ||||.|| ||| |
YLTSYISQGGFGCVFEAKYNEEIVAVK
Kinase n1218.AA Ciliate-C5 83-116 57 0.000575 8.67 In-house 78-112 (260) Show / Hide 
Range on Protein: 83-116
Range on HMM: 78-112/260
Sequence Identity: 57% (20 aa)

NLKDTIKSFFGSKKTQLLNQKQALVFR-STVFEKI
|||| ..|||  |||  |||   .  . |||||||
NLKDIMQSFFDQKKTLPLNQIIGFAIQMSTVFEKI