Gene n378 (Tetrahymena)
n378
Species: Tetrahymena
Alias: n378, 378, 3718.m00109
External Links:
Annotation:
Group:
Other
Family:
Ciliate-Unique
Sequence
Protein domains of n378.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | n378.AA | HisK | 2071-2118 | 20 | 3.1e-08 | 26.36 | In-house | 1-77 (164) | Show / Hide |
Range on Protein: 2071-2118 Range on HMM: 1-77/164 Sequence Identity: 20% (16 aa) TDQNALRQIIYNLLYNAIQNTPKNG-----FIALRVQ---------------VDSKYN---------DCIKIKIRNS .|.| ..||. ||. ||. | |.| .| . |. . . .| ..|.| . . SDPNRIKQILINLISNALKFTQKGGIPFQGYIKIKVEQINTQNNIKYNSIFIQKIQENMVQEQLQQKNLIQISVQDT |
|||||||||
| HATPase_c | n378.AA | HATPase_c | 2071-2118 | 35 | 5.7e-07 | 26.51 | Pfam | 1-45 (120) | Show / Hide |
Range on Protein: 2071-2118 Range on HMM: 1-45/120 Sequence Identity: 35% (17 aa) TDQNALRQIIYNLLYNAIQNTPKNGFIALRVQVDSKYNDCIKIKIRNS .|...|.|.. ||. |||. ||..| | .|| | | . | .... GDPDRLHQVVWNLVDNAIKHTPEGGHITVRVHRDD---DHVRITVEDN |
|||||||||
| Kinase | n378.AA | HisK | 2156-2177 | 35 | 0.00513 | 7.52 | In-house | 121-148 (164) | Show / Hide |
Range on Protein: 2156-2177 Range on HMM: 121-148/164 Sequence Identity: 35% (10 aa) LGLRISQRLIKILGPT------DKIILK ||| |...|.|.|||. ..| .. LGLTICNNLAKGLGPEHNQNGNRGIQVQ |
|||||||||