30951

Species: M.brevicollis
Alias: 30951
External Links:
Annotation:

Classification

Group: TK-assoc
Family: PTB
Subfamily: Unque

Sequence

Name Sequence Type Origin Length Description Download
30951.AA Protein None 343 None Fasta, JSON

Protein domain

Protein domains of 30951.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
PTB 30951.AA PTB 3-152 16 0.000204 12.59 SMART 5-156 (156) Show / Hide
Range on Protein: 3-152
Range on HMM: 5-156/156
Sequence Identity: 16% (28 aa)

EYQLTYKGFIYVKQGK-------GDDSGAVTLDEVRRCAALLNKPKKARDIHPLFARGFATPLKLKLIPDGLRVYVFNEETKQDLVVMDHPLHRIVFVVA
.. ..| | . |.. .       |..  .  ....|                     .  .. |  |      | . ...||   |...||.||| |...
CFNVWYLGCVEVPHHRNSMAPGKGMQVCQECMRKIR--------------------QHWKHWQKMHLHISVDGVKLIDPQTK--QVIHHHPIHRISFCAH

D--------------DKDVYVVAKHELRG----KGTMYKCHGFRCSSDKEAKQTSNAVTRACNECLAKLRATREF
|              |. . ....|.       . ....||.|.| ... |.... .. .|.  |  .  . |. 
DPYRWNTGGHHCCDDDRCFGYICRHPNDRGSHRMTYWFRCHVFWCEDPH-AEDIAQTIGQAFQVCYQQCQKQRCQ