Gene 38069 (M.brevicollis)

38069

Species: M.brevicollis
Alias: 38069
External Links:
Annotation:

Classification

Group: TK-assoc
Family: SH2
Subfamily: Unique

Sequence

Name Sequence Type Origin Length Description Download
38069.AA Protein None 318 None Fasta, JSON

Protein domain

Protein domains of 38069.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
SH2 38069.AA SH2 224-300 35 1.7e-25 76.68 Pfam 1-81 (81) Show / Hide 
Range on Protein: 224-300
Range on HMM: 1-81/81
Sequence Identity: 35% (29 aa)

WFHMTVDRQKAESMLRKAGLQDGMFLIRPAS-KPRCYALTMCRHG---RILHNTIEAVGHRYRYVGPDRTFDSLADLVEHY
|.|  . ||.|| .|.. | .|| ||.|. . .| .|.|. .. |   |. |  |   . .  |.. ...|.||..|||||
WYHGKISRQEAERLLMNPGNPDGTFLVRESESTPGDYTLSVRDDGPGDRVKHYRIQRTDNGGYYITGRHKFCSLQELVEHY
SH2 38069.AA SH2 222-306 31 1.2e-23 85.78 SMART 1-87 (87) Show / Hide 
Range on Protein: 222-306
Range on HMM: 1-87/87
Sequence Identity: 31% (28 aa)

PPWFHMTVDRQKAESMLRKAGLQDGMFLIRPASK-PRCYALTMCRHGRILHNTIEAVGHRYRYVGP--DRTFDSLADLVEHYMYGTRS
 ||.|  ..|..||..|.. | .|| ||.|. .. |..|.|... .|.. |  |.  ...  |..   .|.|.|| .||.||.    .
QPWYHGNISREEAEQLLKNPGMPDGDFLVRDSESNPGDYVLSVRWKGKVKHYRIRRNDDGKYYIDETWRRKFPSL-ELVNHYQHNPLG