Gene 34788 (M.brevicollis)

34788

Species: M.brevicollis
Alias: 34788
External Links:
Annotation:

Classification

Group: TK-assoc
Family: SH2
Subfamily: Unique

Sequence

Name Sequence Type Origin Length Description Download
34788.AA Protein None 375 None Fasta, JSON

Protein domain

Protein domains of 34788.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
PH 34788.AA PH 36-130 23 1.2e-09 39.27 SMART 1-82 (82) Show / Hide 
Range on Protein: 36-130
Range on HMM: 1-82/82
Sequence Identity: 23% (22 aa)

GALCGYLRKRGEHRRALKLRWVVLYEGHCYYYTTSEASAPKGLFSLRNYTLTTNTETLELRLERGKQDRVWVFEALAHNDLPAWSQRFRDAIKSW
  ..|.|.|..  .   | ||.||...  |||  .   .||| ..|...|..  . ..|..   .    ...| .  . ..  | | ...||.. 
VIKEGWLYKKS--K-RWKKRWFVLFNDCLYYYKDK---KPKGSIPLSDCTVRE-P-CFEIHH-DR----TYYFQCESEEEMQEWMQAIQKAIHNN
PH 34788.AA PH 36-128 25 4e-08 31.93 Pfam 1-92 (92) Show / Hide 
Range on Protein: 36-128
Range on HMM: 1-92/92
Sequence Identity: 25% (24 aa)

GALCGYLRKRGEHRRALKLRWVVLYEGHCYYYTTSEASAPKGLFSLRNYTLTTNTE---TLELRLERGKQDRVWVFEALAHNDLPAWSQRFRDAIK
  ..|.|.|.|  |.  | ||.|| ... |||  .  . ||| ..|.. ..|. ..      ...    . |...|.|    ..  | | ...|..
VIKEGWLHKKG-KRKSWKKRWFVLFNNCLYYYKDDK-YRPKGSIPLSDCQVTKVPDNKRPHCFQIRT-DR-RTYYFQAESEEEMNDWMQAIQSACR
SH2 34788.AA SH2 269-349 31 1e-19 72.77 SMART 1-87 (87) Show / Hide 
Range on Protein: 269-349
Range on HMM: 1-87/87
Sequence Identity: 31% (28 aa)

CSYFVSGMTRSQANLLVYQ----DGSFLVRQRDA-DSPLVLSVRLKSSVRHYKIFKTS--AYTLGGDDARYFADPEELIQYYQHHFLP
. ..   ..|..|  |  .    ||.||||...     .||||| |. |.||.|...    | ..... |.| .  ||...|||. |.
QPWYHGNISREEAEQLLKNPGMPDGDFLVRDSESNPGDYVLSVRWKGKVKHYRIRRNDDGKYYIDETWRRKFPSL-ELVNHYQHNPLG
SH2 34788.AA SH2 271-343 28 3.2e-19 58.24 Pfam 1-81 (81) Show / Hide 
Range on Protein: 271-343
Range on HMM: 1-81/81
Sequence Identity: 28% (24 aa)

YFVSGMTRSQANLLVYQ----DGSFLVRQRD-ADSPLVLSVRLKS---SVRHYKIFKTSA--YTLGGDDARYFADPEELIQYY
..   ..|..|  | ..    ||.||||...      .|||| ..   .|.||.| .|    | ..|..   |..  ||...|
WYHGKISRQEAERLLMNPGNPDGTFLVRESESTPGDYTLSVRDDGPGDRVKHYRIQRTDNGGYYITGRHK--FCSLQELVEHY