Gene 26443 (M.brevicollis)

26443

Species: M.brevicollis
Alias: 26443
External Links:
Annotation:

Classification

Group: TK-assoc
Family: SH2
Subfamily: Unique

Sequence

Name Sequence Type Origin Length Description Download
26443.AA Protein None 811 None Fasta, JSON

Protein domain

Protein domains of 26443.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
SH2 26443.AA SH2 47-137 28 4.4e-12 47.39 SMART 1-87 (87) Show / Hide 
Range on Protein: 47-137
Range on HMM: 1-87/87
Sequence Identity: 28% (27 aa)

ASWFVSGMPRTEVRQMAMDMLKK--GRPGNFLIRDVKSEPNCYGMSVRTTQNKLVNYLIEKRAQPPGFCIRG-TKRTFPTVAKLVEFYAQEKRQ
  |.   ..| |    | ..||.  ...| ||.||  |.|..|  |||.  .|  .|.|.. .   ...| . ..|.||..  ||..| . .  
QPWYHGNISREE----AEQLLKNPGMPDGDFLVRDSESNPGDYVLSVRWK-GKVKHYRIRRNDD-GKYYIDETWRRKFPSL-ELVNHYQHNPLG
SH2 26443.AA SH2 49-131 24 6.6e-10 30.92 Pfam 1-81 (81) Show / Hide 
Range on Protein: 49-131
Range on HMM: 1-81/81
Sequence Identity: 24% (21 aa)

WFVSGMPRTEVRQMAMDMLKK--GRPGNFLIRDVKSEPNCYGMSVRTTQNKLVNYLIEKRAQPPGFCIRGTKRTFPTVAKLVEFY
|.   ..|    | | ..|..  ...| ||.|.  |.|..|  |||.  .  ... . .. .. |   ......|.... |||.|
WYHGKISR----QEAERLLMNPGNPDGTFLVRESESTPGDYTLSVRDDGPGDRVKHYRIQRTDNGGYYITGRHKFCSLQELVEHY