Gene 8549 (M.brevicollis)

8549

Species: M.brevicollis
Alias: 8549
External Links:
Annotation:

Classification

Group: TK-assoc
Family: SH2
Subfamily: Unique

Sequence

Name Sequence Type Origin Length Description Download
8549.AA Protein None 227 None Fasta, JSON

Protein domain

Protein domains of 8549.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
SH2 8549.AA SH2 115-198 29 7.6e-13 49.92 SMART 1-87 (87) Show / Hide 
Range on Protein: 115-198
Range on HMM: 1-87/87
Sequence Identity: 29% (27 aa)

YNWYVGEIKRTAIETVLHQ--HPPGTYLVRR----GGAHVIFTVKQPAALGDFNHIKILVEEDGTCSISD--SESFKSIPELVRFYHIYWLQ
..|| | | |   |  | .   |.|..|||      |. |.    .    | . |..|  ..||  .| .  ...| |. |||..|.   | 
QPWYHGNISREEAEQLLKNPGMPDGDFLVRDSESNPGDYVLSVRWK----GKVKHYRIRRNDDGKYYIDETWRRKFPSL-ELVNHYQHNPLG
SH2 8549.AA SH2 159-192 29 6.1e-07 22.2 Pfam 45-81 (81) Show / Hide 
Range on Protein: 159-192
Range on HMM: 45-81/81
Sequence Identity: 29% (11 aa)

G---DFNHIKILVEEDGTCSISDSESFKSIPELVRFY
|    . |..|  ...|.  |.. . | |..||| .|
GPGDRVKHYRIQRTDNGGYYITGRHKFCSLQELVEHY
SH2 8549.AA SH2 117-142 46 0.000851 12.97 Pfam 1-28 (81) Show / Hide 
Range on Protein: 117-142
Range on HMM: 1-28/81
Sequence Identity: 46% (13 aa)

WYVGEIKRTAIETVLHQ--HPPGTYLVR
|| | | |   |  | .   |.||.|||
WYHGKISRQEAERLLMNPGNPDGTFLVR