Gene 27039 (M.brevicollis)

27039

Species: M.brevicollis
Alias: 27039
External Links:
Annotation:

Classification

Group: TK-assoc
Family: SH2
Subfamily: SH2-R-HYR

Sequence

Name Sequence Type Origin Length Description Download
27039.AA Protein None 1024 None Fasta, JSON

Protein domain

Protein domains of 27039.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
NCD3G 27039.AA NCD3G 236-261 25 0.092815 7.19 Pfam 28-54 (54) Show / Hide 
Range on Protein: 236-261
Range on HMM: 28-54/54
Sequence Identity: 25% (7 aa)

CDTCAAGSYRS-AGMNECAVCADGTEP
|  |..|.| .  .. .|  | ..  |
CIPCPEGEYSNTTDSYTCTPCPEDQWP
NCD3G 27039.AA NCD3G 268-294 29 0.003719 11.34 Pfam 28-54 (54) Show / Hide 
Range on Protein: 268-294
Range on HMM: 28-54/54
Sequence Identity: 29% (8 aa)

CVSCTGAEYRDASSMNECAACPLGSDP
|. |.. || . . . .|  ||..  |
CIPCPEGEYSNTTDSYTCTPCPEDQWP
SH2 27039.AA SH2 922-1008 24 1.7e-11 45.46 SMART 1-87 (87) Show / Hide 
Range on Protein: 922-1008
Range on HMM: 1-87/87
Sequence Identity: 24% (22 aa)

FPWLHEGLSRQEAEALLSQFVDSDGTYLVRDRAQ--DSYALSMIFNRAISHHLLKKDG-SGFWLVNEIKYEPACTELGSLIMQLRTRAGH
 || |  .||.|||.|| .    ||..||||. .   .|.||. ... . | ...... .....  .   .. .  |  |.   .. .. 
QPWYHGNISREEAEQLLKNPGMPDGDFLVRDSESNPGDYVLSVRWKGKVKHYRIRRNDDGKYYIDET--WRRKFPSL-ELVNHYQHNPLG
SH2 27039.AA SH2 924-989 30 1.2e-10 33.12 Pfam 1-72 (81) Show / Hide 
Range on Protein: 924-989
Range on HMM: 1-72/81
Sequence Identity: 30% (22 aa)

WLHEGLSRQEAEALLSQFVDSDGTYLVRDRA--QDSYALSMIFNR---AISHHLLKKDGSG-FWLVNEIKYE
| |  .|||||| || .    |||.|||..   . .|.||  ..     . |   .... | . .  . |..
WYHGKISRQEAERLLMNPGNPDGTFLVRESESTPGDYTLSVRDDGPGDRVKHYRIQRTDNGGYYITGRHKFC