Gene 29190 (Tetrahymena)
29190
Group:
Other
Family:
Ciliate-D1
Sequence
Protein domains of 29190.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | 29190.AA | MST | 1167-1192 | 38 | 0.000137 | 10.42 | In-house | 231-254 (254) | Show / Hide |
Range on Protein: 1167-1192 Range on HMM: 231-254/254 Sequence Identity: 38% (10 aa) IRKCLRYEAVSRPSALELLLEIHEFI ..||| . |..| .|| |.|| VCKCLQKNPEQRWTAEQLLQ--HPFI |
|||||||||
| S_TKc | 29190.AA | S_TKc | 889-1192 | 10 | 0.000144 | -109.94 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 889-1192
Range on HMM: 1-231/231
Sequence Identity: 10% (38 aa)
YQFEG----------RLVQNLPPRLNQDEI---IMHSDERDVKRQLGHFTINNQIFSKWVVKSKYLFEDNGDTNFLNLAFNVSPY-FLNIYAISHQDSSI
|.. ..... . . |.. .. . | . ...|| .. |.| ..| . . . . . . .. .
YEILRKIGKGAFGKVYKCRHKK---TGRIVAIKIIK------EHIRREIQILKK-HHPNIVKLYDVFQD----DHLYMVMEYCDGDLGDLFDYIKKRGRH
-----LTEPYLCTF----------------------------EELCQNKLSDYNIDEQLSVSLCVSLHNSELYGYISFFGKNILLVDNEGFIKTPNFL--
..| . . | . |..| . || |. ||...
GLRFPFPE-HARFYMYQICCALEYCHSHGIIHRDLKPENILLDE--HIKICDFGLARQL-----------------------------TTFCGTPWYMAP
-VLVDGSFQLDWNTIPHELLLEEGPQQQLS--KCDIWGIGSLLLYLFYGKSIVNETNSQKQVDKYLQDVNKFKTQEYLDDLFAQFNIKSEKNTKNQQDQK
|| . . |||.| .| .| ...|. |... .. .
EVL------------------------GYGKCKCDWWSCGCILYEMLCGYPPFP------QMQMMFKKIG------------------------------
EHQNEESNQPGRYFEVSSMSYEFRWLLESIIRKCLRYEAVSRPSALELLLEI-----HEFI
. ... .|||||... ||.| |.| . |...
----------------------SPEAKD-FIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF
|
|||||||||
| Kinase | 29190.AA | STE20 | 1167-1192 | 42 | 0.000186 | 12.54 | In-house | 265-288 (288) | Show / Hide |
Range on Protein: 1167-1192 Range on HMM: 265-288/288 Sequence Identity: 42% (11 aa) IRKCLRYEAVSRPSALELLLEIHEFI . ||| .. ||.| .|| |.|| VDKCLQKDPEKRPTASQLLK--HPFI |
|||||||||
| Kinase | 29190.AA | STE | 1167-1192 | 46 | 0.000199 | 11.69 | In-house | 334-359 (359) | Show / Hide |
Range on Protein: 1167-1192 Range on HMM: 334-359/359 Sequence Identity: 46% (12 aa) IRKCLRYEAVSRPSALELLLEIHEFI |.|||... ||.| .|| . |.|| INKCLQKDPNKRPTASQLLKSEHPFI |
|||||||||
| Kinase | 29190.AA | Ste20-DD1 | 1167-1192 | 46 | 0.00045 | 9.62 | In-house | 245-268 (268) | Show / Hide |
Range on Protein: 1167-1192 Range on HMM: 245-268/268 Sequence Identity: 46% (12 aa) IRKCLRYEAVSRPSALELLLEIHEFI |. || .. |||| .|| | || IKQCLNMNPDKRPSAQQLL--NHPFI |
|||||||||
| Kinase | 29190.AA | NRBP | 1166-1191 | 50 | 0.000764 | 9.04 | In-house | 236-261 (261) | Show / Hide |
Range on Protein: 1166-1191 Range on HMM: 236-261/261 Sequence Identity: 50% (13 aa) IIRKCLRYEAVSRPSALELLLEIHEF .|||||. . |||| ||| | FIRKCLQKDPARRPSARELLFHQILF |
|||||||||
| MORN | 29190.AA | MORN | 1676-1698 | 26 | 36.602151 | 1.72 | Pfam | 1-23 (23) | Show / Hide |
Range on Protein: 1676-1698 Range on HMM: 1-23/23 Sequence Identity: 26% (6 aa) YKGGLLNGKYWDYGRLYSNNRLV | | ||| .|... . . YEGEWKNGKMHGHGVYTWPDGDR |
|||||||||
| MORN | 29190.AA | MORN | 1751-1773 | 30 | 0.002687 | 16.73 | Pfam | 1-23 (23) | Show / Hide |
Range on Protein: 1751-1773 Range on HMM: 1-23/23 Sequence Identity: 30% (7 aa) YEGDFSLDLYHGFGKILYDGGKK |||... .. ||.|. . | . YEGEWKNGKMHGHGVYTWPDGDR |
|||||||||
| MORN | 29190.AA | MORN | 1749-1770 | 31 | 0.014726 | 8.08 | SMART | 1-22 (22) | Show / Hide |
Range on Protein: 1749-1770 Range on HMM: 1-22/22 Sequence Identity: 31% (7 aa) DIYEGDFSLDLYHGFGKILYDG |.|||.. .. ||.|. . DRYEGEWHNGKRHGHGVYWWAN |
|||||||||
| MORN | 29190.AA | MORN | 1736-1750 | 40 | 0.398146 | 8.85 | Pfam | 9-23 (23) | Show / Hide |
Range on Protein: 1736-1750 Range on HMM: 9-23/23 Sequence Identity: 40% (6 aa) KKHGKGTLYMRNGDI |.||.|... .|| KMHGHGVYTWPDGDR |
|||||||||
| MORN | 29190.AA | MORN | 1776-1798 | 34 | 0.015573 | 13.96 | Pfam | 1-23 (23) | Show / Hide |
Range on Protein: 1776-1798 Range on HMM: 1-23/23 Sequence Identity: 34% (8 aa) FEGVFNEGLKHGVGVYCDKIKGI .|| . .|..|| ||| . . YEGEWKNGKMHGHGVYTWPDGDR |
|||||||||
| MORN | 29190.AA | MORN | 1823-1845 | 47 | 4e-06 | 27.17 | Pfam | 1-23 (23) | Show / Hide |
Range on Protein: 1823-1845 Range on HMM: 1-23/23 Sequence Identity: 47% (11 aa) YQGNFKEGKKHGHGVIYYKKGKI |.|..|.||.||||| ... | YEGEWKNGKMHGHGVYTWPDGDR |
|||||||||
| MORN | 29190.AA | MORN | 1821-1842 | 40 | 1.8e-05 | 25.4 | SMART | 1-22 (22) | Show / Hide |
Range on Protein: 1821-1842 Range on HMM: 1-22/22 Sequence Identity: 40% (9 aa) HEYQGNFKEGKKHGHGVIYYKK |.|....||.||||| ... DRYEGEWHNGKRHGHGVYWWAN |
|||||||||
| MORN | 29190.AA | MORN | 1848-1870 | 26 | 0.005503 | 15.6 | Pfam | 1-23 (23) | Show / Hide |
Range on Protein: 1848-1870 Range on HMM: 1-23/23 Sequence Identity: 26% (6 aa) YDGTFEDDKKHGGGIEIDENDNK |.|.. ..|.|| |. . . .. YEGEWKNGKMHGHGVYTWPDGDR |
|||||||||
| MORN | 29190.AA | MORN | 1846-1867 | 31 | 0.014955 | 8.03 | SMART | 1-22 (22) | Show / Hide |
Range on Protein: 1846-1867 Range on HMM: 1-22/22 Sequence Identity: 31% (7 aa) KYYDGTFEDDKKHGGGIEIDEN |.|.. ..|.|| |. . | DRYEGEWHNGKRHGHGVYWWAN |
|||||||||