Gene YGL059W (Bakers Yeast)
YGL059W
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| YGL059W.AA | Protein | Refseq_NP | 445 | Hypothetical ORF; Ygl059wp [Saccharomyces cerevisiae] | Fasta, JSON |
Protein domains of YGL059W.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| BCDHK_Adom3 | YGL059W.AA | BCDHK_Adom3 | 78-245 | 24 | 5.5e-57 | 197.69 | Pfam | 1-199 (199) | Show / Hide |
Range on Protein: 78-245
Range on HMM: 1-199/199
Sequence Identity: 24% (49 aa)
NPVSLTQLAQYYDDSTKLTRTKIINSGKFVKEELVIRIAHKLNQLQQLPFNVVNNFHFVQVYESYYNIFESFRK-Y--------------PTIRTLED--
|.|| |..|. ..... ....|..|..||| ||.||... || ||.......|..|||..||. ||..|. . |...||||
TPLSLRQMMQF--GRPNPCEKTLFKSAQFCHEELPIRLAHRIRELQNLPYGLNKMPHIQQVYNWYYQSFEELRECFPKPISELKHLRYYEPPPKTLEDWL
---ASQFADFIKNMLEGFN-TLNLPHLIMGALECTILDLY-----PRE----KMDQLLSDLLRARISR---RLIVEEHVVYTA-NYTSGKE--ENTLVLG
..|.|.... .. .. . .|.. .| ||. ...| | . .... |.. ...||.. |.....|. . ||.. .. ... |
HDYNEKFCDMLRDIKDRHDRNV-VPTMAQGVLEWK-CRYYGQDNQPDDLHWFQIQYFLDRFYMSRIGINFIRMLIGQHIALFEFNYHNPHHFEHPDY-VG
DIFQ
|..
IICT
|
|||||||||
| Kinase | YGL059W.AA | PDHK | 289-348 | 38 | 1.3e-11 | 37.02 | In-house | 1-59 (140) | Show / Hide |
Range on Protein: 289-348 Range on HMM: 1-59/140 Sequence Identity: 38% (23 aa) FLPTHLKYLLGEILRNTYEATMKHYIRKGLEKPEPIIVTVVSNDESYLFRISDKAGGVLH . | || ..| | . | ||| |. .. | || |.|. .|| ..||. ||| | YVPMHLYHMLFELFKNAMRATMEHHEDRPYNYP-PIKVMVALGDEDLTIKMSDRGGGVPH |
|||||||||
| Kinase | YGL059W.AA | PDHK | 289-346 | 32 | 5e-06 | 18.57 | In-house | 1-56 (125) | Show / Hide |
Range on Protein: 289-346 Range on HMM: 1-56/125 Sequence Identity: 32% (19 aa) FLPTHLKYLLGEILRNTYEATMKHYIRKGLEKPEPIIVTVVSNDESYLFRISDKAGGV . | || .| |. .| ||. |. .. || | |. .| ..||. ||| YVPSHLYHMLFELFKNAMRATVEHHENRK--IYPPIKVMVTLGKEDLTIKMSDRGGGV |
|||||||||