Gene T10B5.2 (Nematode worm)

T10B5.2

Species: Nematode worm
Alias: aSWK265, CE18232, T10B5.2
External Links: Wormbase Link ,
Annotation: WormBase Genetic Map location: V:-17.02, WormBase Physical Map location: V: 1855450-1848836

Classification

Group: Other
Family: Worm2

Sequence

Name Sequence Type Origin Length Description Download
T10B5.2.kin_dom Protein Kinase Domain Sugen global kinase HMM prediction 227 Kinase domain by global Sugen HMM Fasta, JSON
T10B5.2.AA Protein Genbank 588 None Fasta, JSON

Protein domain

Protein domains of T10B5.2.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase T10B5.2.AA Worm2 242-477 89 2.5e-206 688.92 In-house 1-242 (242) Show / Hide 
Range on Protein: 242-477
Range on HMM: 1-242/242
Sequence Identity: 89% (216 aa)

FKHISEETKVMLGLTPMFCKEDVIGNMGRAVFRYLALTQYQQTFYHFHYRATINFDSAGSKEAQILCKLNKNRSHNAMRVMKYGQYLNLQYILTPQV---
|||||.|||||||..|||||.||||||||.|.|||||.||.|||||||||||||||||||||||||||||.||||||||||.||||||||||||.||   
FKHISKETKVMLGNMPMFCKDDVIGNMGRVVCRYLALNQYHQTFYHFHYRATINFDSAGSKEAQILCKLNMNRSHNAMRVMRYGQYLNLQYILTQQVGYL

--GDLGFLVQNTTLDLYSAVHLIQQTFYCISDLHK-GYTHLDIRPSSFSLLRNNTSIVVLNNFFNSETRQNIRRNICTTKHNGLQPLYVQQARHARNKLE
   ||||.||||||||||.|||||||||||||||| .|.|||||||||||||||..||||||||||||||||||||||||||||||||||||||||||.|
LHWDLGFIVQNTTLDLYSSVHLIQQTFYCISDLHKICYHHLDIRPSSFSLLRNNKAIVVLNNFFNSETRQNIRRNICTTKHNGLQPLYVQQARHARNKSE

REPLPKNVINTYLSRRQHFRLARGPADDYESWFYICARFITL
||||||||||||.|||||||||||||||||||||||||||||
REPLPKNVINTYMSRRQHFRLARGPADDYESWFYICARFITL
Kinase T10B5.2.AA CK1 447-520 21 0.000533 9.94 In-house 237-327 (339) Show / Hide 
Range on Protein: 447-520
Range on HMM: 237-327/339
Sequence Identity: 21% (20 aa)

YLSRRQHFRLARGPADDYESWFYICARFITLFE---WHDEEDHIM-----AATMKYNYLAT--CTFPDFQTNER---------MATILQYCLS
| |.. | .   |. || .||||  . ..       |.. .|. .        |||.. ..  . .|.|  ..          . .|..|. |
YCSINCHLGKEQGRRDDLWSWFYMLIEWLKGTPGLPWQNMKDEMKPKDHQVEKMKYEFIDEKKMSTPFF-LCCPKKDHDCPQEF-KIMKYIRS