F37E3.3

Species: Nematode worm
Alias: aSWK255, F37E3.3, CE09999
External Links: Wormbase Link ,
Annotation: WormBase Physical Map location: I: 6439589-6437672, WormBase Genetic Map location: I:1,

Classification

Group: Other
Family: Other-Unique

Sequence

Name Sequence Type Origin Length Description Download
F37E3.3.kin_dom Protein Kinase Domain Sugen global kinase HMM prediction 272 Kinase domain by global Sugen HMM Fasta, JSON
F37E3.3.AA Protein Genbank 419 None Fasta, JSON

Protein domain

Protein domains of F37E3.3.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase F37E3.3.AA Other-Unique 129-385 9 2.4e-29 96.86 In-house 1-249 (249) Show / Hide
Range on Protein: 129-385
Range on HMM: 1-249/249
Sequence Identity: 9% (26 aa)

LGLSSTNVHNICKTGKRIKDKKIQSQDFFHLVYTGEMKFADGKIKKALFEELHNPTISDLKVFYENLVEGKALAARNLPIRLPIGAILNPPTLIYEHQEN
. ..  .... .. ....|.||.......|...  .|. . .   |.. ...|.. |.. ..||.. .....|.. ..    .| .|..|.   ..|.|.
IKDIGKGTYGRVYKQHHNKKKKYCAKKTKHHKI-HCMDMDNN---KRE-QIYHYQ-IIH-CIFYWT-MNHCHLCFCYEHCPNMIFYIMYPWY--HHHCEC

QVGCSLKDFLKNFDTHLDLAQRIKLCSAAVRILSELHRFDIYHGASKVD--------NFYVLGYKNEKTMNYELVFNGASGLLYEGKSDNTVTMVDYDSN
|. |..... ......|. ... ...   .   . .......|  .. .        ... .........   ....  .. .....|. | .. ... .
QCQCEHWMNCCHMIHNLHHLHNNNHIHCDINPNNIWINQNNIHMCHNCGHNIPTIIIEHQHIKIMDFNNN-N-MMYFAPEF-SCRWCSPETFDYWPLGEK

APEVAFTRKLSKESGVFTLGRLFEQILESEILKSYSEPPQEEPRVLNDMRRLIGRATRANPSQRP
 ....| .......  . . . ... . . ...|.... . ... .....  . .  ..||....
IDQYHFGCYHFHMNCQHWIFHYHDV-QHWPPHESPKDI-HILICQCECCHQCM-VNPYQNPNCFY

Kinase F37E3.3.AA TKL 357-394 17 0.000236 11.6 In-house 318-364 (364) Show / Hide
Range on Protein: 357-394
Range on HMM: 318-364/364
Sequence Identity: 17% (8 aa)

EPP---------QEEPRVLNDMRRLIGRATRANPSQRPTMNGIVMLI
..|         . .| .. .|..|. .   ..|..||... |.  .
PIPPIWQNHHKMCPCPDCPPSMKKLMQDCWDHDPEKRPSFQEILKRL