Gene F22H10.5 (Nematode worm)

F22H10.5

Species: Nematode worm
Alias: CE09574, aSWK221, F22H10.5
External Links: Wormbase Link ,
Annotation: WormBase Physical Map location: X: 16687713-16685617, WormBase Genetic Map location: X:23.98,

Classification

Group: Other
Family: Haspin

Sequence

Name Sequence Type Origin Length Description Download
F22H10.5.AA Protein Genbank 340 None Fasta, JSON
F22H10.5.kin_dom Protein Kinase Domain Sugen global kinase HMM prediction 248 Kinase domain by global Sugen HMM Fasta, JSON

Protein domain

Protein domains of F22H10.5.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase F22H10.5.AA Haspin 95-340 46 5.4e-126 424.87 In-house 1-252 (264) Show / Hide 
Range on Protein: 95-340
Range on HMM: 1-252/264
Sequence Identity: 46% (116 aa)

NIAKIGEGCYAEAFSTIFNNQSVVMKVLPCRDISN---GEKCGEHTQGIDAVIAELAILKSLSALSTKNHANVTENFVKMVMAKVVIGKHPTSLLKAWDT
|..|||||||.|.||...|...||||..|... ..   ||.||||.|..|....|..|.|....||..|......||..|.....| ||....|.|.||.
NCKKIGEGCYGEVFSVTWNGKEVVMKIIPIHWSCCKYYGEYCGEHQQTNDEALNEIIIMKKMGKLSHRNMCPNFPNFCGMCVVTQVPGKCCKKLNKMWDH

YRVEEESENIRPSKFNKNQLYLVLILSKGGTALEKF--KMESIDQFHSIMQQLVYSLAIAETELQFEHRDLHLGNVLID-KTGAEELEFVLNNRPVRIKL
|.....|||.||..|.||||....|...||..|..|  |.....|..|||.|||.|..||..|.||.|.|||.|||||. ||. ..|.. .... ..|| 
YCYTHHSENDRPDFFKKNQLHIHWIMEYGGRPLDNFRWKFNTCNQCISIMCQLVMSMYIAKDEMQFWHNDLHWGNVLIKRKTKKKWLHYTMDGKTIKIKS

RGVRVTIIDFTWSRIQEGGKTIYVDTEIDTAMFEGFSDSQFDVYREMRRNCQ
.|| ||||||..||.....|.|| | . |..|||.|.|.||||||.||.|||
HGVMVTIIDFCKSRCGKDNKKIYWDWKNDETMFEQFWDYQFDVYRDMRKNCQ