Gene C04G2.10 (Nematode worm)

C04G2.10

Species: Nematode worm
Alias: CE05218, aSWK222, C04G2.10
External Links: Wormbase Link ,
Annotation: WormBase Genetic Map location: IV:4.51, WormBase Physical Map location: IV: 10116809-10117998,

Classification

Group: Other
Family: Haspin

Sequence

Name Sequence Type Origin Length Description Download
C04G2.10.kin_dom Protein Kinase Domain Sugen global kinase HMM prediction 216 Kinase domain by global Sugen HMM Fasta, JSON
C04G2.10.AA Protein Genbank 332 None Fasta, JSON

Protein domain

Protein domains of C04G2.10.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase C04G2.10.AA Haspin 93-306 28 2.9e-85 289.59 In-house 1-248 (264) Show / Hide 
Range on Protein: 93-306
Range on HMM: 1-248/264
Sequence Identity: 28% (70 aa)

VEGKLGEGLRGIAYKVKHRNTMKCLKLLPLSWTSR-------------NKEALEDLVALRSLKTIKKE--TPNYLTFFDSFVLTNLPASTQDKLNQLDPQ
.. |.||| .| ...|.........|..|. |...             |.|||...............  .||...|....| |..|.....|||.....
NCKKIGEGCYGEVFSVTWNGKEVVMKIIPIHWSCCKYYGEYCGEHQQTNDEALNEIIIMKKMGKLSHRNMCPNFPNFCGMCVVTQVPGKCCKKLNKMWDH

CPATH---------------YLGLLVELGSNSLDN--TMLTTAVEGLSIVKQLVLSLVIAKRRLDTNHNDVHPGNVLVKRSASPKTLKYTLDGKVIRIPS
...||               .. ...|.|...|||  ....|. . .||..|||.|..|||......|||.|.||||.||....|.|.||.|||.|.|.|
YCYTHHSENDRPDFFKKNQLHIHWIMEYGGRPLDNFRWKFNTCNQCISIMCQLVMSMYIAKDEMQFWHNDLHWGNVLIKRKTKKKWLHYTMDGKTIKIKS

HGLVVGIIDFSEASFGRANGN--SDVGFLSFITEEISKTLSKAENRTF
||..| ||||.....|..| .  .|. ......|..............
HGVMVTIIDFCKSRCGKDNKKIYWDWKNDETMFEQFWDYQFDVYRDMR