Gene SgK424 (Mouse)

SgK424

Species: Mouse
Alias: SgK424
External Links: Entrez Gene , Refseq cDNA , Refseq Protein , iHOP
Annotation:

Classification

Group: Other
Family: NKF5

Sequence

Name Sequence Type Origin Length Description Download
SgK424.AA Protein Sugen 469 None Fasta, JSON
SgK424.NA RNA Sugen 1467 None Fasta, JSON
SgK424.kin_dom Protein Kinase Domain Sugen global kinase HMM prediction 77 Kinase domain by global Sugen HMM Fasta, JSON

Protein domain

Protein domains of SgK424.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Ank SgK424.AA Ank 25-57 39 7e-06 25.42 Pfam 1-33 (33) Show / Hide 
Range on Protein: 25-57
Range on HMM: 1-33/33
Sequence Identity: 39% (13 aa)

AGQTALFLSALLGHTSAVRLLLAFGANPNHPHP
 |.|.| | .. |||. |..||  ||..|.   
DGFTPLHLACRCGHTEVVKMLLQHGADVNAQDD
Kinase SgK424.AA NKF5 372-469 56 2.1e-64 193.74 In-house 74-171 (176) Show / Hide 
Range on Protein: 372-469
Range on HMM: 74-171/176
Sequence Identity: 56% (55 aa)

LPPPPELYPWLPLELIHGDVPATTSDLYSFCILAQEVFTGELPWAGGEGPEVKAKLEAGQSPGLDPLLPAPYQALVQAGLGLEPADRWGSLQSTRYLL
.| |  || |   |.|..|.|...||.|||||..||.||.|.||||..|||||||.|||..|..||.|||||...|.||..|...|||..||  ||.|
MPLPTQLYNWAAPEVICQDMPTVKSDIYSFCIIMQEIFTDEIPWAGRDGPEVKAKIEAGNYPEADPRLPAPYYDIVKAGIHLKQKDRWMNLQDIRYIL
Kinase SgK424.AA RTKL 381-444 33 0.000125 7.64 In-house 172-243 (259) Show / Hide 
Range on Protein: 381-444
Range on HMM: 172-243/259
Sequence Identity: 33% (24 aa)

WLPLELIHGDVPATTSDLYSFCILAQEVFTGELPWAGGEGPEVKAKLE--------AGQSPGLDPLLPAPYQ
|. .|   |      ||   | ... || ||  |.|.   | | | |         ||  |||. |  | .|
WMSPETLNGKPHTMASDVWAFGVVCYEVITGQVPYADTDMPQVVALLKNEGRLALPAGTPPGLERLVAACWQ
Kinase SgK424.AA RIPK 396-441 27 0.000358 10.08 In-house 209-255 (290) Show / Hide 
Range on Protein: 396-441
Range on HMM: 209-255/290
Sequence Identity: 27% (13 aa)

SDLYSFCILAQEVFTGELPWAGGEGPEVK-AKLEAGQSPGLDPLLPA
.| ||| |.  ||.|.  | .. . .... .....|. | |.|. ..
YDVYSFAIVMWEVLTQKHPYEDRKCMMMIMMCCKQGHRPCLQPVPEY