Gene 89650.m00190 (T.vaginalis)
89650.m00190
Species: T.vaginalis
Alias: 89650.m00190, TvagK1009
External Links:
Annotation:
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
89650.m00190.AA | Protein | None | 92 | None | Fasta, JSON |
89650.m00190.kin_dom | Protein Kinase Domain | None | 32 | None | Fasta, JSON |
Protein domains of 89650.m00190.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | 89650.m00190.AA | DYRK2 | 19-50 | 59 | 2.1e-14 | 42.96 | In-house | 1-32 (318) | Show / Hide |
Range on Protein: 19-50 Range on HMM: 1-32/318 Sequence Identity: 59% (19 aa) YRILKTIGKGSYATVVSAFDTKLKQTVAIKML | ||. |||||.. || ..| |.|| |||||. YEILEVIGKGSFGQVVKCYDHKTKQHVAIKMI |
|||||||||
Kinase | 89650.m00190.AA | MARK | 19-50 | 50 | 3.9e-13 | 39.44 | In-house | 1-32 (262) | Show / Hide |
Range on Protein: 19-50 Range on HMM: 1-32/262 Sequence Identity: 50% (16 aa) YRILKTIGKGSYATVVSAFDTKLKQTVAIKML |..|||||.||||.| | ... .. ||||.. YKMLKTIGHGSYAKVKLACHKHTGRKVAIKIY |
|||||||||
Kinase | 89650.m00190.AA | CAMKL | 19-50 | 45 | 1.4e-12 | 36.34 | In-house | 1-33 (297) | Show / Hide |
Range on Protein: 19-50 Range on HMM: 1-33/297 Sequence Identity: 45% (15 aa) YRILKTIGKGSYATVVSAFDTKL-KQTVAIKML |||.||.||||...| | .... .. ||||.. YRIGKTLGKGSFGKVKLATHIRTTGEKVAIKII |
|||||||||
Kinase | 89650.m00190.AA | DYRK | 19-50 | 50 | 2.4e-12 | 42.71 | In-house | 1-32 (320) | Show / Hide |
Range on Protein: 19-50 Range on HMM: 1-32/320 Sequence Identity: 50% (16 aa) YRILKTIGKGSYATVVSAFDTKLKQTVAIKML |.||. |||||.. || ..|.| .. ||||.. YEILEYIGKGSFGQVVKCWDHKTNEMVAIKII |
|||||||||
Kinase | 89650.m00190.AA | Ciliate-E3 | 19-58 | 35 | 6.7e-11 | 30.53 | In-house | 1-42 (202) | Show / Hide |
Range on Protein: 19-58 Range on HMM: 1-42/202 Sequence Identity: 35% (15 aa) YRILKTIGKGSYATVVSAFDTKLKQTVAIKMLIANSSQS--V | ... .|.|.. | |||. ..| |||| .| |. | YTVQQILGCGQFGRVYKAFDFQNNQDVAIKAIICQNQQNEGV |
|||||||||
Kinase | 89650.m00190.AA | CMGC | 19-48 | 29 | 8.2e-11 | 30.82 | In-house | 1-44 (513) | Show / Hide |
Range on Protein: 19-48 Range on HMM: 1-44/513 Sequence Identity: 29% (13 aa) YRILKTIGKGSYATVVSAFD--------------TKLKQTVAIK | |.| ||.|.|..|....| .. .. |||| YEIIKKIGEGTYGVVYKCRDKRTNQKKDNGQAHHHETNEIVAIK |
|||||||||
Kinase | 89650.m00190.AA | MAPK | 19-48 | 44 | 1e-10 | 33.06 | In-house | 1-36 (328) | Show / Hide |
Range on Protein: 19-48 Range on HMM: 1-36/328 Sequence Identity: 44% (16 aa) YRILKTIGKGSYATVVSAFDTK------LKQTVAIK |.||| ||.|.| .|.||.|.. ...|||| YQILKPIGQGAYGVVCSAIDKRTNQKTKCGKKVAIK |
|||||||||
Kinase | 89650.m00190.AA | ERK | 19-48 | 45 | 5.3e-10 | 33.61 | In-house | 1-35 (307) | Show / Hide |
Range on Protein: 19-48 Range on HMM: 1-35/307 Sequence Identity: 45% (16 aa) YRILKTIGKGSYATVVSAFDTK-----LKQTVAIK |.|.| ||.|.| .|.||.|.. |.|||| YQIIKQIGHGAYGVVCSAIDKEYCFDETGQKVAIK |
|||||||||
Kinase | 89650.m00190.AA | TSSK | 19-48 | 34 | 2e-09 | 27.11 | In-house | 1-46 (289) | Show / Hide |
Range on Protein: 19-48 Range on HMM: 1-46/289 Sequence Identity: 34% (16 aa) YRILKTIGKGSYATVVSAFDTKLKQT----------------VAIK | |.||.||||.| .|...| | . |||| YNVGKKIGHGSYAKVYCAYSKKHKCKHNPRLRDDLRIKRHTHVAIK |
|||||||||
Kinase | 89650.m00190.AA | CDK7 | 19-48 | 50 | 3.1e-09 | 20.3 | In-house | 1-30 (288) | Show / Hide |
Range on Protein: 19-48 Range on HMM: 1-30/288 Sequence Identity: 50% (15 aa) YRILKTIGKGSYATVVSAFDTKLKQTVAIK | ..| || | .||| | |.. | |||| YEKIKHIGEGQFATVYKACDHQTGQIVAIK |
|||||||||
Kinase | 89650.m00190.AA | Pkinase | 19-50 | 31 | 1.6e-05 | 20.64 | Pfam | 1-32 (293) | Show / Hide |
Range on Protein: 19-50 Range on HMM: 1-32/293 Sequence Identity: 31% (10 aa) YRILKTIGKGSYATVVSAFDTKLKQTVAIKML |.|...||.||...| . . . ..||.| . YHIGRKIGSGSFGCVYKCHHKGTGKIVAVKII |