TVAG_185120

Species: T.vaginalis
Alias: TVAG_185120, TvagK1054
External Links:
Annotation:

Classification

Group: CMGC
Family: CMGC-Tvag1

Sequence

Name Sequence Type Origin Length Description Download
TVAG_185120.AA Protein None 866 None Fasta, JSON
TVAG_185120.kin_dom Protein Kinase Domain None 249 None Fasta, JSON

Protein domain

Protein domains of TVAG_185120.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase TVAG_185120.AA CDKL 164-201 44 0.00033 10.29 In-house 182-218 (286) Show / Hide
Range on Protein: 164-201
Range on HMM: 182-218/286
Sequence Identity: 44% (17 aa)

DCWAIGAMLCEYLIYGHPIFMSSSDTDQMLITQTILGP
| |||| .. | .| |.|.. ..|| ||.   |  |||
DIWAIGCVMAE-MIDGQPLWPGQSDIDQLYHIQKCLGP