Gene TVAG_224230 (T.vaginalis)

TVAG_224230

Species: T.vaginalis
Alias: TVAG_224230, TvagK1059
External Links:
Annotation:

Classification

Group: CAMK
Family: CAMKL
Subfamily: CAMKL-Tvag2

Sequence

Name Sequence Type Origin Length Description Download
TVAG_224230.AA Protein None 267 None Fasta, JSON
TVAG_224230.kin_dom Protein Kinase Domain None 109 None Fasta, JSON

Protein domain

Protein domains of TVAG_224230.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase TVAG_224230.AA Ciliate-E2 67-102 27 0.000727 9.13 In-house 106-150 (365) Show / Hide 
Range on Protein: 67-102
Range on HMM: 106-150/365
Sequence Identity: 27% (13 aa)

DQNLFIRYEYFPGGDLYSLIK-----------SGETKNFSLVQKLKI
|.|...  ||. ||||...||           . . |.|.. . ..|
DNNIYLVMEYCQGGDLFDYIKNNKKKRNHEIEK-D-KYFTEKEIKYI