Gene TVAG_094240 (T.vaginalis)
TVAG_094240
Species: T.vaginalis
Alias: TVAG_094240, TvagK1042
External Links:
Annotation:
Group:
TKL
Family:
TKL-Unique
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
TVAG_094240.AA | Protein | None | 562 | None | Fasta, JSON |
TVAG_094240.kin_dom | Protein Kinase Domain | None | 173 | None | Fasta, JSON |
Protein domains of TVAG_094240.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | TVAG_094240.AA | NRBP | 187-273 | 28 | 2e-06 | 18.27 | In-house | 172-261 (261) | Show / Hide |
Range on Protein: 187-273 Range on HMM: 172-261/261 Sequence Identity: 28% (26 aa) APELS---SADYNYKVDIFELGKILLEAESILKNGEKFNIESFDIKQLHNKAAEYFTEGDELGDIIKQCLDKDPNNRPTDIDILNQCKVF ||| .| |||. | || . | || ... . | | . |.|..|| ||| .||. ..| .| APEYGILEVTDLTTAVDIYSFGMCALEMAVLEIQSGCQNGESEYVTEEAIQRAIHSLEDPMQRDFIRKCLQKDPARRPSARELLFHQILF |
|||||||||
Kinase | TVAG_094240.AA | Dicty3 | 247-267 | 28 | 3e-06 | 16.57 | In-house | 331-351 (351) | Show / Hide |
Range on Protein: 247-267 Range on HMM: 331-351/351 Sequence Identity: 28% (6 aa) DIIKQCLDKDPNNRPTDIDIL ..|..|.. |||.|. .. .. NFIQHCWQIDPNHRWDMHELI |
|||||||||
Kinase | TVAG_094240.AA | FRAY | 247-273 | 44 | 7e-06 | 13.91 | In-house | 252-277 (277) | Show / Hide |
Range on Protein: 247-273 Range on HMM: 252-277/277 Sequence Identity: 44% (12 aa) DIIKQCLDKDPNNRPTDIDILNQCKVF ..|..|| ||| .||| | ..|.| KMIEKCLQKDPSKRPTASELL-KHKFF |
|||||||||
Kinase | TVAG_094240.AA | ARK | 245-269 | 40 | 1.1e-05 | 16.9 | In-house | 256-280 (280) | Show / Hide |
Range on Protein: 245-269 Range on HMM: 256-280/280 Sequence Identity: 40% (10 aa) LGDIIKQCLDKDPNNRPTDIDILNQ | . |..|.|.||.|||. .|. LKNLIQCCWDQDPDNRPSCEEIMEE |
|||||||||
Kinase | TVAG_094240.AA | NZAK | 243-271 | 37 | 2.1e-05 | 13.58 | In-house | 301-329 (329) | Show / Hide |
Range on Protein: 243-271 Range on HMM: 301-329/329 Sequence Identity: 37% (11 aa) DELGDIIKQCLDKDPNNRPTDIDILNQCK | . |.|.||.| ||..|| | .. DKMKDFITQCWDIDPKKRPKDFSHMIEKL |
|||||||||
Kinase | TVAG_094240.AA | Ciliate-A2 | 243-271 | 30 | 2.5e-05 | 14.76 | In-house | 243-272 (272) | Show / Hide |
Range on Protein: 243-271 Range on HMM: 243-272/272 Sequence Identity: 30% (9 aa) DELGDIIKQCLDKDPNNRP-TDIDILNQCK ... .||.| | .||..|| .. |. . . EKCNQIIQQILNCDPKKRPSSIQQIRHHWH |
|||||||||
Kinase | TVAG_094240.AA | WEE | 242-272 | 32 | 4.9e-05 | 12.92 | In-house | 267-297 (297) | Show / Hide |
Range on Protein: 242-272 Range on HMM: 267-297/297 Sequence Identity: 32% (10 aa) GDELGDIIKQCLDKDPNNRPTDIDILNQCKV ..|| ..||. ...|| .||| ..|.. .. SQELKQLIKWMMHPDPEQRPTCQQLLQHPVL |
|||||||||
Kinase | TVAG_094240.AA | NEK | 243-272 | 36 | 6.4e-05 | 13.7 | In-house | 257-286 (286) | Show / Hide |
Range on Protein: 243-272 Range on HMM: 257-286/286 Sequence Identity: 36% (11 aa) DELGDIIKQCLDKDPNNRPTDIDILNQCKV ..| ..| |.| ||| .||. .||... . QDLQNLISQMLQKDPEQRPSCNQILEMPFI |
|||||||||
Kinase | TVAG_094240.AA | SLK | 244-272 | 41 | 9.2e-05 | 11.86 | In-house | 231-259 (259) | Show / Hide |
Range on Protein: 244-272 Range on HMM: 231-259/259 Sequence Identity: 41% (12 aa) ELGDIIKQCLDKDPNNRPTDIDILNQCKV | |..|.||.|||.||.| .... | EFKDFLKKCLVKDPQNRWTTAQLMQHQWV |
|||||||||
Kinase | TVAG_094240.AA | PEK | 247-272 | 34 | 0.000161 | 10.81 | In-house | 630-655 (655) | Show / Hide |
Range on Protein: 247-272 Range on HMM: 630-655/655 Sequence Identity: 34% (9 aa) DIIKQCLDKDPNNRPTDIDILNQCKV |.|...|..|| .||. .||.. . DFIQWMLSHDPQQRPSAQQILQHEFF |
|||||||||
Kinase | TVAG_094240.AA | PEK | 186-210 | 38 | 0.006733 | 5.06 | In-house | 556-586 (655) | Show / Hide |
Range on Protein: 186-210 Range on HMM: 556-586/655 Sequence Identity: 38% (12 aa) SAPELSSAD------YNYKVDIFELGKILLE ..||. | || |||.. || |..| MSPEQLSGQHYQKSHYNHKVDMYSLGIIFFE |