Gene TVAG_211830 (T.vaginalis)

TVAG_211830

Species: T.vaginalis
Alias: TvagK1036, TVAG_211830
External Links:
Annotation:

Classification

Group: Atypical
Family: TAF1

Sequence

Name Sequence Type Origin Length Description Download
TVAG_211830.AA Protein None 394 None Fasta, JSON

Protein domain

Protein domains of TVAG_211830.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
DUF3591 TVAG_211830.AA DUF3591 221-382 24 3.3e-25 92.81 Pfam 28-210 (494) Show / Hide 
Range on Protein: 221-382
Range on HMM: 28-210/494
Sequence Identity: 24% (44 aa)

GLEICHSDVAKE----LYLVDPNPKDIESLHHPRLNIKEIKGKTLS-----VSIDPKSFVD------NEEEHIFLK--DFESLSARNGKIMILLEIVSEN
.|.| ||..|..     | | .|.....| |.|..... ..| . .       ....          .     ..|  ....|. ...   ||.|   |.
NLNIEHSMPALRLQWPYYKVKLNKREARSFHRPHFQFYIRPGTQIWVRFSKLKHRKRKHDKREKERMGKDISEVFKMRTTKDLTLGDNSPVILMEYCEEY

PPFILNVGMASQLVTYYHMRSSDDKPRLETD--TRISYIEPDQLSPM--LAPIPKGTPFCTIANNLFEIPVAKHPVENTDFLL
||.. |.||.| ...||. .. .| .|   |    .... |.. ||   .. ...|..  |. ||..  |..||..|.||||.
PPVMSNFGMGSKIINYYRKKHMEDTHRPKLDDIGETHVLHPQDKSPFWNFGHVHPGEIVPTLYNNMYRAPIFKHKPEPTDFLC