Gene LmjF.16.0110 (L.major)

LmjF.16.0110

Species: L.major
Alias: LmjF.16.0110, LmajK224
External Links:
Annotation:

Classification

Group: PKL
Family: CAK
Subfamily: ACAD

Sequence

Name Sequence Type Origin Length Description Download
LmjF.16.0110.AA Protein None 826 None Fasta, JSON
LmjF.16.0110.kin_dom Protein Kinase Domain None 316 None Fasta, JSON

Protein domain

Protein domains of LmjF.16.0110.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
APH LmjF.16.0110.AA APH 451-535 20 7e-06 20.99 Pfam 1-83 (248) Show / Hide 
Range on Protein: 451-535
Range on HMM: 1-83/248
Sequence Identity: 20% (18 aa)

LFEYVEGSRFFESYRLTLRTG-SYILRIQPRGPSPYGSADIRREYETMAHLYETSPGLQIPTPLLYCDSYAVCGRRFFLRRYRDGE
  . ..| . ...|..|   . .|.||. |..   . .....||.. ..|| .  . ...| .| .|    ..|... | .. .||
WWRPISGGWSNRTYYRTTDDRPRYVLRRYPPP---WWAEELHREHRWLRHLAAHGIPVPVPRVLWGCTDDEFHGWPWYLMEWLPGE