Gene LmjF27.1420 (L.major)

LmjF27.1420

Species: L.major
Alias: LmajK165, LmjF27.1420
External Links:
Annotation:

Classification

Group: PKL
Family: CAK
Subfamily: ChoK

Sequence

Name Sequence Type Origin Length Description Download
LmjF27.1420.AA Protein None 642 None Fasta, JSON
LmjF27.1420.kin_dom Protein Kinase Domain None 295 None Fasta, JSON

Protein domain

Protein domains of LmjF27.1420.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Choline_kinase LmjF27.1420.AA Choline_kinase 280-303 33 0.074716 8.93 Pfam 1-24 (225) Show / Hide 
Range on Protein: 280-303
Range on HMM: 1-24/225
Sequence Identity: 33% (8 aa)

PSASVVVRVFGKETDRVISRESEL
   ...||..|. |. .| || |.
HPRKYLVRIYGQGTEHFIDRETEI
Choline_kinase LmjF27.1420.AA Choline_kinase 468-525 28 5.3e-12 46.72 Pfam 157-225 (225) Show / Hide 
Range on Protein: 468-525
Range on HMM: 157-225/225
Sequence Identity: 28% (20 aa)

CHNDLLSANVMI--HKVRKDVRVIDFDYTKRSFLLYDVANHFNEYPG---------LDCDYDTYFPSDA
|||||.. |.|.   .  .... ||. |    . ..| ||||.|. .          .|||. |   . 
CHNDLQYGNIMYIEDNETNCLMFIDWEYASYNYRAFDIANHFCEWMYDYHWPEPPFHKCDYSKYPNREQ
APH LmjF27.1420.AA APH 456-511 29 7e-06 20.9 Pfam 160-220 (248) Show / Hide 
Range on Protein: 456-511
Range on HMM: 160-220/248
Sequence Identity: 29% (18 aa)

LERQKAYLP-EGVCHNDLLSANVMIHKVRKD-VR---VIDFDYTKRSFLLYDVANHF-NEYP
... .| .| ...||.|. . |||..  | |  |   |||.|.      .||.| .. ....
WAWLEAHWPPPCWCHGDFHPGNVMWDP-RPDGGRVTGVIDWDDACWGDPHYDLAMCWWHWWC