Gene IRAK-Un_dd (S.moellendorffii)
IRAK-Un_dd
Species: S.moellendorffii
Alias: IRAK-Un_dd
External Links:
Annotation:
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
IRAK-Un_dd.AA | Protein | None | 136 | None | Fasta, JSON |
IRAK-Un_dd.NA | RNA | None | 411 | None | Fasta, JSON |
IRAK-Un_dd.kin_dom | Protein Kinase Domain | None | 32 | None | Fasta, JSON |
Protein domains of IRAK-Un_dd.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | IRAK-Un_dd.AA | TKL | 27-59 | 29 | 1.7e-07 | 23.05 | In-house | 161-207 (364) | Show / Hide |
Range on Protein: 27-59 Range on HMM: 161-207/364 Sequence Identity: 29% (14 aa) IIRRDLRPHNILLTHDYA--------------PMVGDFGLARWHTSS || ||| ..|||. .. . ..||||.|... | IIHRDLKSKNILVDENWTNVSNYMYNPNADWCCKICDFGLSRFMSQS |
|||||||||
Kinase | IRAK-Un_dd.AA | RAF | 27-54 | 50 | 1e-06 | 17.11 | In-house | 124-151 (282) | Show / Hide |
Range on Protein: 27-54 Range on HMM: 124-151/282 Sequence Identity: 50% (14 aa) IIRRDLRPHNILLTHDYAPMVGDFGLAR || |||. ||.| | .|||||.. IIHRDLKSNNIFLHEDMTVKIGDFGLMT |
|||||||||
Kinase | IRAK-Un_dd.AA | CMGC | 30-55 | 32 | 4e-06 | 15.31 | In-house | 208-253 (513) | Show / Hide |
Range on Protein: 30-55 Range on HMM: 208-253/513 Sequence Identity: 32% (15 aa) RDLRPHNILLTHDYAP--------------------MVGDFGLARW ||| | |||..|. ..||||||| RDLKPENILINHNCELITRMMWKSEDWNPCQKNGRLKICDFGLARW |
|||||||||
Kinase | IRAK-Un_dd.AA | NEK-Unclassified | 27-54 | 57 | 8e-06 | 14.92 | In-house | 118-145 (258) | Show / Hide |
Range on Protein: 27-54 Range on HMM: 118-145/258 Sequence Identity: 57% (16 aa) IIRRDLRPHNILLTHDYAPMVGDFGLAR || |||.| || || | |||| .| IIHRDLKPQNIFLTDDDTVSMGDFGISR |
|||||||||
Kinase | IRAK-Un_dd.AA | NEK10 | 27-54 | 42 | 9e-06 | 14.79 | In-house | 141-168 (279) | Show / Hide |
Range on Protein: 27-54 Range on HMM: 141-168/279 Sequence Identity: 42% (12 aa) IIRRDLRPHNILLTHDYAPMVGDFGLAR |. |||.| ||... . . |||||. IVHRDLTPNNIMMGDKDRVTITDFGLAK |
|||||||||
Kinase | IRAK-Un_dd.AA | CDK-Unclassified | 27-54 | 39 | 1.4e-05 | 14.16 | In-house | 142-174 (324) | Show / Hide |
Range on Protein: 27-54 Range on HMM: 142-174/324 Sequence Identity: 39% (13 aa) IIRRDLRPHNILLTHDY---APMV--GDFGLAR |. ||. | ||..|. .||. .|||.|. IMHRDIKPQNIMITNNNSTVSPMLKIADFGQAC |
|||||||||
Kinase | IRAK-Un_dd.AA | CDK4 | 27-54 | 60 | 1.9e-05 | 14.42 | In-house | 131-158 (290) | Show / Hide |
Range on Protein: 27-54 Range on HMM: 131-158/290 Sequence Identity: 60% (17 aa) IIRRDLRPHNILLTHDYAPMVGDFGLAR || ||| | |||.| | |||||| IIHRDLKPQNILVTSDGHVKLADFGLAR |
|||||||||
Kinase | IRAK-Un_dd.AA | ERK7 | 25-54 | 56 | 3.3e-05 | 13.43 | In-house | 119-148 (292) | Show / Hide |
Range on Protein: 25-54 Range on HMM: 119-148/292 Sequence Identity: 56% (17 aa) GTIIRRDLRPHNILLTHDYAPMVGDFGLAR | .| |||.| |||| . | |||||| GNVIHRDLKPSNILLDSECMVKVCDFGLAR |
|||||||||
Kinase | IRAK-Un_dd.AA | MLK | 26-61 | 33 | 3.4e-05 | 14.11 | In-house | 147-194 (291) | Show / Hide |
Range on Protein: 26-61 Range on HMM: 147-194/291 Sequence Identity: 33% (16 aa) TIIRRDLRPHNILLTH------DYAPMVGDFGLAR-WHTS-----SQP .||.||| .||||... . . |||..| ||.. |.. PIIHRDLKSHNILIDEICHDMHHGTLKICDFGTSRDWHQMCTNMMSNA |
|||||||||
Kinase | IRAK-Un_dd.AA | CAMK | 27-54 | 28 | 5.4e-05 | 11.25 | In-house | 200-244 (425) | Show / Hide |
Range on Protein: 27-54 Range on HMM: 200-244/425 Sequence Identity: 28% (13 aa) IIRRDLRPHNILLTHD-----------------YAPMVGDFGLAR |. ||| | ||||... . . |||.|. IVHRDLKPENILLDDNNDDSDPVEHDEIFDWNNNNIKIIDFGFAN |
|||||||||
Kinase | IRAK-Un_dd.AA | Pkinase | 30-61 | 33 | 0.000827 | 14.55 | Pfam | 132-168 (293) | Show / Hide |
Range on Protein: 30-61 Range on HMM: 132-168/293 Sequence Identity: 33% (13 aa) RDLRPHNILLTHDYAP----MVGDFGLAR---WHTSSQP ||| | |||. ... . ..|||||. . .| . RDLKPENILIDNNGHIDACVKICDFGLAKQFDY-NNS-M |