Gene IRAK-Un_co (S.moellendorffii)
IRAK-Un_co
Species: S.moellendorffii
Alias: IRAK-Un_co
External Links:
Annotation:
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
IRAK-Un_co.AA | Protein | None | 63 | None | Fasta, JSON |
IRAK-Un_co.NA | RNA | None | 192 | None | Fasta, JSON |
IRAK-Un_co.kin_dom | Protein Kinase Domain | None | 39 | None | Fasta, JSON |
Protein domains of IRAK-Un_co.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | IRAK-Un_co.AA | HH498 | 2-33 | 53 | 1.3e-10 | 29.42 | In-house | 140-171 (284) | Show / Hide |
Range on Protein: 2-33 Range on HMM: 140-171/284 Sequence Identity: 53% (17 aa) AASPPIYHRDVKSSNILLDEKLTANVADFGIS .. .|| ||| | |||..| | |||||.| SLKHPIIHRDLNSHNILIHEDGHAVVADFGES |
|||||||||
Kinase | IRAK-Un_co.AA | TKL | 5-36 | 39 | 3.4e-10 | 32.93 | In-house | 159-204 (364) | Show / Hide |
Range on Protein: 5-36 Range on HMM: 159-204/364 Sequence Identity: 39% (18 aa) PPIYHRDVKSSNILLDEKLT--------------ANVADFGISKVV ||| ||| ||.|||.||..| . ..|||.|... PPIIHRDLKSKNILVDENWTNVSNYMYNPNADWCCKICDFGLSRFM |
|||||||||
Kinase | IRAK-Un_co.AA | NuaK | 7-35 | 55 | 1.1e-09 | 21.11 | In-house | 120-148 (252) | Show / Hide |
Range on Protein: 7-35 Range on HMM: 120-148/252 Sequence Identity: 55% (16 aa) IYHRDVKSSNILLDEKLTANVADFGISKV | ||| | |||||.. | .|||| | . ICHRDLKLENILLDQNCNAKIADFGLSNY |
|||||||||
Kinase | IRAK-Un_co.AA | TKL-Unique | 5-35 | 47 | 7.5e-09 | 27.53 | In-house | 131-166 (290) | Show / Hide |
Range on Protein: 5-35 Range on HMM: 131-166/290 Sequence Identity: 47% (17 aa) PPIYHRDVKSSNILLDEK-----LTANVADFGISKV |||.||| ||||.|.|.. . . ..|||.||. PPIIHRDLKSSNFLVDNNSNIAEWNIKICDFGLSKF |
|||||||||
Kinase | IRAK-Un_co.AA | CZAK | 5-34 | 38 | 7.7e-09 | 28.4 | In-house | 127-170 (279) | Show / Hide |
Range on Protein: 5-34 Range on HMM: 127-170/279 Sequence Identity: 38% (17 aa) P-PIYHRDVKSSNILLDEKLT-------------ANVADFGISK | || ||| |.|||||. .| . ..||| |. PNPILHRDLSSRNILLDHSYTPKNPVVSSRQDIICKINDFGLSR |
|||||||||
Kinase | IRAK-Un_co.AA | Dicty4-Unclassified | 7-36 | 56 | 8.3e-09 | 26.25 | In-house | 130-159 (263) | Show / Hide |
Range on Protein: 7-36 Range on HMM: 130-159/263 Sequence Identity: 56% (17 aa) IYHRDVKSSNILLDEKLTANVADFGISKVV . |||.||||||.| . .|||||| |. FIHRDIKSSNILMDKHFNIKIADFGISRVI |
|||||||||
Kinase | IRAK-Un_co.AA | IRAK | 3-31 | 51 | 8.4e-09 | 27.49 | In-house | 128-158 (317) | Show / Hide |
Range on Protein: 3-31 Range on HMM: 128-158/317 Sequence Identity: 51% (16 aa) ASP--PIYHRDVKSSNILLDEKLTANVADFG ..| || |.|.||.|||||. .|. .||| NHPCTPIIHGDIKSANILLDQHFTPKICDFG |
|||||||||
Kinase | IRAK-Un_co.AA | MLK | 5-34 | 47 | 1.3e-08 | 26.15 | In-house | 146-181 (291) | Show / Hide |
Range on Protein: 5-34 Range on HMM: 146-181/291 Sequence Identity: 47% (17 aa) PPIYHRDVKSSNILLDE------KLTANVADFGISK .|| ||| ||.|||.|| ..|. ..|||.|. KPIIHRDLKSHNILIDEICHDMHHGTLKICDFGTSR |
|||||||||
Kinase | IRAK-Un_co.AA | Dicty5 | 7-36 | 46 | 1.3e-08 | 25.71 | In-house | 125-154 (260) | Show / Hide |
Range on Protein: 7-36 Range on HMM: 125-154/260 Sequence Identity: 46% (14 aa) IYHRDVKSSNILLDEKLTANVADFGISKVV | |||.|| |.|. | ... . |||.| | IIHRDLKSMNFLITENWKIKIIDFGTSRFV |
|||||||||
Kinase | IRAK-Un_co.AA | RAF | 7-35 | 51 | 1.9e-08 | 23.2 | In-house | 124-152 (282) | Show / Hide |
Range on Protein: 7-35 Range on HMM: 124-152/282 Sequence Identity: 51% (15 aa) IYHRDVKSSNILLDEKLTANVADFGISKV | ||| || ||.|.| .| . ||| .| IIHRDLKSNNIFLHEDMTVKIGDFGLMTV |
|||||||||
Kinase | IRAK-Un_co.AA | Pkinase | 7-35 | 39 | 8e-07 | 25.2 | Pfam | 129-161 (293) | Show / Hide |
Range on Protein: 7-35 Range on HMM: 129-161/293 Sequence Identity: 39% (13 aa) IYHRDVKSSNILLDEKLTA----NVADFGISKV | |||.|..|||.|.. . ..|||..|. IIHRDLKPENILIDNNGHIDACVKICDFGLAKQ |